Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_I23
         (595 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    24   0.98 
L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein pro...    22   5.2  

>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 24.2 bits (50), Expect = 0.98
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 479 LNLILFRNKNTKHE*TESRSXLHIKVQISQPRPGTHK 589
           LN++ F NKN K+E     + + + + + +   G HK
Sbjct: 79  LNVLYFINKNDKYEENTILTTMPLLINVVKYLGGKHK 115


>L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein
           protein.
          Length = 81

 Score = 21.8 bits (44), Expect = 5.2
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 210 KQLFSCKYC 236
           K+ FSCKYC
Sbjct: 14  KKSFSCKYC 22


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,604
Number of Sequences: 438
Number of extensions: 2446
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17359926
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)