BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I22 (510 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S... 69 4e-13 SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa... 69 4e-13 SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch... 26 3.8 >SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 68.9 bits (161), Expect = 4e-13 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = +3 Query: 258 GKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPNSNS 437 GKVHGSLARAGKVK QTPKVE GRA +R+ Y RRFVNV G +R N +S Sbjct: 2 GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 >SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 1|||Manual Length = 61 Score = 68.9 bits (161), Expect = 4e-13 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = +3 Query: 258 GKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPNSNS 437 GKVHGSLARAGKVK QTPKVE GRA +R+ Y RRFVNV G +R N +S Sbjct: 2 GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 >SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 25.8 bits (54), Expect = 3.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 468 YFCILFTYKSMNWSW 424 YFC+++T S N+SW Sbjct: 748 YFCVVYTGGSSNFSW 762 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,592,112 Number of Sequences: 5004 Number of extensions: 23188 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -