BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I19 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 3.8 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 22 3.8 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 22 5.0 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 22 5.0 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 5.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.8 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 8.8 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.8 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.8 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 153 TEIYMFIPKQYSELSKRNNTQNNCLRFRFY 64 TE+ PK+ S R N ++ C R + Y Sbjct: 248 TELTKMRPKRQSSRRHRKNLKDPCRRRQMY 277 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 248 LITCCTIVHFHFYYFSTSIETADISVCSHFEKL 150 LI C IV F YY S + V + +L Sbjct: 254 LIKNCVIVIFELYYLSHVCQNVSTEVIGNILRL 286 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 91 LCIVTFTEFRILFWYKHI 144 L ++TFT +I+ + +HI Sbjct: 204 LLLITFTSLQIMVYLQHI 221 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 91 LCIVTFTEFRILFWYKHI 144 L ++TFT +I+ + +HI Sbjct: 204 LLLITFTSLQIMVYLQHI 221 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 91 LCIVTFTEFRILFWYKHI 144 L ++TFT +I+ + +HI Sbjct: 524 LLLITFTSLQIMVYLQHI 541 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 431 YMIIESRPVLSFKIYLNHCH 372 Y+ ES PV+ +++H H Sbjct: 444 YLFFESPPVVFLNDFISHQH 463 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 431 YMIIESRPVLSFKIYLNHCH 372 Y+ ES PV+ +++H H Sbjct: 444 YLFFESPPVVFLNDFISHQH 463 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 431 YMIIESRPVLSFKIYLNHCH 372 Y+ ES PV+ +++H H Sbjct: 444 YLFFESPPVVFLNDFISHQH 463 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 431 YMIIESRPVLSFKIYLNHCH 372 Y+ ES PV+ +++H H Sbjct: 444 YLFFESPPVVFLNDFISHQH 463 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 437 NNYMIIESRPVLSFKIYLNH 378 NN ++ E + KIY NH Sbjct: 114 NNVLLTELEKYPNVKIYFNH 133 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 437 NNYMIIESRPVLSFKIYLNH 378 NN ++ E + KIY NH Sbjct: 114 NNVLLTELEKYPNVKIYFNH 133 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 437 NNYMIIESRPVLSFKIYLNH 378 NN ++ E + KIY NH Sbjct: 114 NNVLLTELEKYPNVKIYFNH 133 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 489 ECYTYVDKTPDKETK 533 +C+ V +TPDK K Sbjct: 196 DCFVKVPRTPDKPGK 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,771 Number of Sequences: 336 Number of extensions: 3128 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -