BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I19 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding pr... 24 4.8 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 6.3 >AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding protein AgamOBP29 protein. Length = 176 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 426 HIVVLSKRRSQLKQAVVKMVQECYTYVDKTPDKETKIKLIETLRTIT 566 H++ R +L++ V +QEC+ + D K K ++R +T Sbjct: 111 HVITKDIREHELREFYVDSIQECFHMLGL--DNRLKDKCDYSMRFVT 155 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = -1 Query: 101 TIHKIIACVLDFTNLTNHXSXSKPTSHDLSSAG 3 T++ ++C +N +H + +P SH+ G Sbjct: 897 TLYSCVSCHKTVSNRWHHANIHRPQSHECPVCG 929 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,207 Number of Sequences: 2352 Number of extensions: 11651 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -