BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I15 (414 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch... 26 2.7 SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogam... 25 4.7 >SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosaccharomyces pombe|chr 1|||Manual Length = 769 Score = 25.8 bits (54), Expect = 2.7 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 195 RLLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIEFRLCD-TVTNYIQL 335 +L + WLF L ++LL SLI N+K ++L D T N++ L Sbjct: 5 KLESKWLFSLTESQKLYLLISLIINKKLPEAKFVYKLLDYTKGNWLSL 52 >SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogamy |Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.0 bits (52), Expect = 4.7 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 298 NSIAFKIAFWLSISERSKCMGPSRCRQNSQEVSRRNMQST 179 N I I L ERS+ + PS C + SQ ++ST Sbjct: 54 NRIHSAIQMTLCDFERSQILAPSECVRGSQSECVSKLEST 93 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 951,993 Number of Sequences: 5004 Number of extensions: 11141 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -