BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I15 (414 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_39926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 29.1 bits (62), Expect = 1.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 319 VTVSHNRNSIAFKIAFWLSISERSKCMG 236 VT+S N +A AFWLS++ R KC G Sbjct: 20 VTLSQN---VAIVTAFWLSVTGREKCGG 44 >SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3066 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +3 Query: 198 LLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIEFRLCDTVTNYIQL 335 LL W +C +LL +L DN+ + + + + C + +QL Sbjct: 256 LLMGWRYCYSCENAQNLLDALWDNEAPVSHPVFHQACQKLAYQVQL 301 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,413,637 Number of Sequences: 59808 Number of extensions: 92759 Number of successful extensions: 2035 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2035 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -