BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I14 (845 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr... 28 1.9 SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|... 26 7.7 >SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 819 Score = 27.9 bits (59), Expect = 1.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 824 IXDKFMKHFLFRKLKWNFRYCFKQYCEXYQVFFKISSL 711 + + +K + + +K + R+CFKQ E Y ++ K L Sbjct: 527 VYETALKLPVIKYVKGDNRFCFKQLLEYYDIYLKFKLL 564 >SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 25.8 bits (54), Expect = 7.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 Query: 457 REGNRSSSVTVVLVAHSAGLDLRAVSDRGVGGELDN 350 REG T+VLV G +L+A G GG ++ Sbjct: 311 REGFAEFLGTLVLVVFGVGSNLQATVTNGAGGSFES 346 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,292,868 Number of Sequences: 5004 Number of extensions: 65841 Number of successful extensions: 175 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 175 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -