BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I13 (547 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1422|AAM71029.1| 154|Drosophila melanogaster CG8857-PB... 178 5e-45 AE013599-1421|AAM71028.1| 155|Drosophila melanogaster CG8857-PC... 178 5e-45 AE013599-1420|AAF58552.1| 155|Drosophila melanogaster CG8857-PA... 178 5e-45 BT004880-1|AAO45236.1| 348|Drosophila melanogaster GH14121p pro... 32 0.58 AE014297-786|AAF54268.1| 348|Drosophila melanogaster CG8043-PA ... 32 0.58 AY122128-1|AAM52640.1| 1188|Drosophila melanogaster GH22749p pro... 31 0.77 AE014296-2482|AAN11790.1| 1188|Drosophila melanogaster CG12316-P... 31 0.77 AE014296-2481|AAF49660.1| 1188|Drosophila melanogaster CG12316-P... 31 0.77 >AE013599-1422|AAM71029.1| 154|Drosophila melanogaster CG8857-PB, isoform B protein. Length = 154 Score = 178 bits (433), Expect = 5e-45 Identities = 82/101 (81%), Positives = 91/101 (90%) Frame = +3 Query: 135 KLPVAALEGTYIDKXCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEK 314 + P A++GTYIDK CP+TG+V IRGRILTGVV+K KMQRTIVIRRDYLH++ KY+RFEK Sbjct: 41 RAPAEAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEK 100 Query: 315 RHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 437 RHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 101 RHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 141 >AE013599-1421|AAM71028.1| 155|Drosophila melanogaster CG8857-PC, isoform C protein. Length = 155 Score = 178 bits (433), Expect = 5e-45 Identities = 83/101 (82%), Positives = 91/101 (90%) Frame = +3 Query: 135 KLPVAALEGTYIDKXCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEK 314 K P A++GTYIDK CP+TG+V IRGRILTGVV+K KMQRTIVIRRDYLH++ KY+RFEK Sbjct: 42 KTPREAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEK 101 Query: 315 RHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 437 RHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 102 RHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 142 >AE013599-1420|AAF58552.1| 155|Drosophila melanogaster CG8857-PA, isoform A protein. Length = 155 Score = 178 bits (433), Expect = 5e-45 Identities = 83/101 (82%), Positives = 91/101 (90%) Frame = +3 Query: 135 KLPVAALEGTYIDKXCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEK 314 K P A++GTYIDK CP+TG+V IRGRILTGVV+K KMQRTIVIRRDYLH++ KY+RFEK Sbjct: 42 KTPREAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEK 101 Query: 315 RHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 437 RHRNMSVH SP FRDVE GDIVTIGECRPLSKTVRFNVLKV Sbjct: 102 RHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKV 142 >BT004880-1|AAO45236.1| 348|Drosophila melanogaster GH14121p protein. Length = 348 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 341 QMHGHIPVPFLEPIVFG*VVKVIAADHDSSLHLHFLNDAG 222 ++HG VPFL+ + V ++ + +S++ HFLN AG Sbjct: 50 RVHGAEVVPFLQGLATNDVARIQSPGGPASMYAHFLNKAG 89 >AE014297-786|AAF54268.1| 348|Drosophila melanogaster CG8043-PA protein. Length = 348 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 341 QMHGHIPVPFLEPIVFG*VVKVIAADHDSSLHLHFLNDAG 222 ++HG VPFL+ + V ++ + +S++ HFLN AG Sbjct: 50 RVHGAEVVPFLQGLATNDVARIQSPGGPASMYAHFLNKAG 89 >AY122128-1|AAM52640.1| 1188|Drosophila melanogaster GH22749p protein. Length = 1188 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 201 SIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHL 341 S++ RI+ + M+ R++ I+ Y HYLPK+ R + HL Sbjct: 252 SVKERIVQFAEKFMRPSRSLAIKSVYAHYLPKFTDQNAATRTILNHL 298 >AE014296-2482|AAN11790.1| 1188|Drosophila melanogaster CG12316-PB, isoform B protein. Length = 1188 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 201 SIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHL 341 S++ RI+ + M+ R++ I+ Y HYLPK+ R + HL Sbjct: 252 SVKERIVQFAEKFMRPSRSLAIKSVYAHYLPKFTDQNAATRTILNHL 298 >AE014296-2481|AAF49660.1| 1188|Drosophila melanogaster CG12316-PA, isoform A protein. Length = 1188 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 201 SIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHL 341 S++ RI+ + M+ R++ I+ Y HYLPK+ R + HL Sbjct: 252 SVKERIVQFAEKFMRPSRSLAIKSVYAHYLPKFTDQNAATRTILNHL 298 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,003,782 Number of Sequences: 53049 Number of extensions: 415076 Number of successful extensions: 976 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2069139900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -