BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I07 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 4.6 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 24 6.0 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 8.0 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +2 Query: 128 DIEKTVKQVQNILQSHSELPRLTREEIIQLMNDIKAE 238 ++ K V ++ H E ++TR++ +QL+ D++ E Sbjct: 239 ELIKFVMEIITHQIDHREKNQITRKDFVQLLIDLRRE 275 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 173 HSELPRLTREEIIQLMNDIKAE 238 H E ++TR++ +QL+ D++ E Sbjct: 254 HREKNQITRKDFVQLLIDLRRE 275 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 95 IAVMTVAESAVDIEKTVKQVQNILQSHSELPRLTR 199 I ++ ES E+T ++N+ Q HS L + R Sbjct: 226 IEMVEQLESMASAERTASAIRNVGQMHSGLLKCIR 260 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,124 Number of Sequences: 2352 Number of extensions: 12512 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -