BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I05 (742 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyce... 28 1.2 SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 27 3.7 SPAC6F6.12 |||autophagy associated protein Atg24|Schizosaccharom... 25 8.6 SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch... 25 8.6 >SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 456 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -3 Query: 143 YNCISRSVCLDFVHFNVDCWCNFN---VRAWYDRM 48 +NC S DF FN+ WC ++ V +YDR+ Sbjct: 209 FNCGDESERADFYAFNMYEWCGYSSMTVSGYYDRI 243 >SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 546 Score = 26.6 bits (56), Expect = 3.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 212 FLGVYLIISKLFWTFWSLYGH 274 F+G +L+ +FW W+ Y H Sbjct: 420 FIGCFLLPISMFWFAWTCYPH 440 >SPAC6F6.12 |||autophagy associated protein Atg24|Schizosaccharomyces pombe|chr 1|||Manual Length = 401 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 487 KKLAKHFTKIINHPITEQSPSIQRYLKN 570 K L ++ T+ HP+ QSP +L+N Sbjct: 107 KLLNRYITRCALHPVLHQSPHFIAFLEN 134 >SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 427 DITKNISELTVLSFRKLDDVKKLAKHFTKIINHPITEQSPSIQ 555 +++ + S VLS R D + H ++ N IT Q P Q Sbjct: 193 EMSNHCSPKIVLSLRPQDKIPDFITHVLELKNKKITYQGPKEQ 235 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,721,456 Number of Sequences: 5004 Number of extensions: 52771 Number of successful extensions: 193 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -