BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I05 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786,201... 33 0.24 03_05_1161 - 30831043-30831151,30831641-30831759,30831880-308319... 29 5.1 07_01_0184 - 1304328-1304951,1305328-1305441,1305549-1305839,130... 28 9.0 03_06_0109 - 31717691-31718311,31719110-31719223,31719316-317196... 28 9.0 03_02_0900 - 12262149-12262565,12262924-12263061,12263387-122634... 28 9.0 02_02_0581 + 11770511-11770527,11770754-11771612,11771652-117717... 28 9.0 >02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786, 2018030-2018122 Length = 1375 Score = 33.1 bits (72), Expect = 0.24 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +1 Query: 430 ITKNISELTVLSFRKLDDVKKLAKHFTKIINHPITEQSPSIQRYLKNLQETHKRIIFQKR 609 + N + V KLD + KH T++I TE++P IQ L LQ K ++ +KR Sbjct: 243 VQNNFHVIWVCMSHKLD----IRKHTTEVIESLATEETPKIQN-LDTLQRKLKNLLLEKR 297 Query: 610 D 612 + Sbjct: 298 E 298 >03_05_1161 - 30831043-30831151,30831641-30831759,30831880-30831906, 30832117-30832158,30832293-30832392,30832481-30832545, 30832619-30832694,30832878-30832939,30833248-30833253, 30834704-30834782,30834890-30834957 Length = 250 Score = 28.7 bits (61), Expect = 5.1 Identities = 23/83 (27%), Positives = 43/83 (51%) Frame = +1 Query: 409 MAENVEDITKNISELTVLSFRKLDDVKKLAKHFTKIINHPITEQSPSIQRYLKNLQETHK 588 M E++E + N+ EL L + + +K + ++++ I E +QR K+LQE +K Sbjct: 122 MGEDLESL--NLKELQQLEQQLENSLKHIRSRKSQLMLESINE----LQRKEKSLQEENK 175 Query: 589 RIIFQKRDSVEVEYIFTTEKKSS 657 + QK +V++ T + SS Sbjct: 176 LVEKQKVQKQQVQWDQTQPQTSS 198 >07_01_0184 - 1304328-1304951,1305328-1305441,1305549-1305839, 1305930-1306238,1306326-1307048 Length = 686 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 131 RCNYIFIFFFLKNLIVFFYS 190 + N IF+FF L+ LI+ FYS Sbjct: 485 KANLIFLFFLLRKLILPFYS 504 >03_06_0109 - 31717691-31718311,31719110-31719223,31719316-31719606, 31719698-31720006,31720098-31720865 Length = 700 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 131 RCNYIFIFFFLKNLIVFFYS 190 + N IF+FF L+ LI+ FYS Sbjct: 500 KANLIFLFFLLRKLILPFYS 519 >03_02_0900 - 12262149-12262565,12262924-12263061,12263387-12263446, 12263557-12263619,12264181-12264243,12264420-12264482, 12265076-12265153,12265673-12266080 Length = 429 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 511 KIINHPITEQSPSIQRYLKNLQETHKRIIFQ 603 ++IN +T Q S++ L L+ET+K ++ Q Sbjct: 215 EVINDALTHQETSLKERLSGLEETNKVLLVQ 245 >02_02_0581 + 11770511-11770527,11770754-11771612,11771652-11771749, 11772903-11773631,11775159-11775231,11775698-11776066, 11777009-11777038 Length = 724 Score = 27.9 bits (59), Expect = 9.0 Identities = 21/61 (34%), Positives = 32/61 (52%) Frame = +1 Query: 415 ENVEDITKNISELTVLSFRKLDDVKKLAKHFTKIINHPITEQSPSIQRYLKNLQETHKRI 594 EN +D K I E+ VL K DD+ K KH ++N+P + +I L+ L TH + Sbjct: 97 ENYQDAHKIIVEI-VLQQHK-DDIPKDVKHLLNLMNNP----NKAISMELEYLICTHASL 150 Query: 595 I 597 + Sbjct: 151 V 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,597,942 Number of Sequences: 37544 Number of extensions: 292334 Number of successful extensions: 793 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -