BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I04 (452 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 1.6 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 22 8.8 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 193 RAEALKRDESHVRVTPWANGRPAHLQKAVPK*RR 294 R+ +R R T W RP K +P+ RR Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 22.2 bits (45), Expect = 8.8 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -1 Query: 275 AFWRCAGRPLAQGVTLT*DSSRFNASARNSCFSDLRSTLAAM 150 A+W AG+P+ QG + DS A+ N + R+ M Sbjct: 71 AYWADAGKPVQQGDSP--DSQNAYANCANEPYCAARTVQGYM 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 336,088 Number of Sequences: 2352 Number of extensions: 5378 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -