BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I04 (452 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51650.1 68414.m05819 ATP synthase epsilon chain, mitochondri... 64 6e-11 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 29 1.5 At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc ... 27 4.5 At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 27 5.9 At3g14710.1 68416.m01860 F-box family protein ; similar to SKP... 27 5.9 At1g22370.2 68414.m09509 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.9 At1g22370.1 68414.m09508 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.9 At5g44960.1 68418.m05514 F-box family protein contains F-box dom... 27 7.8 >At1g51650.1 68414.m05819 ATP synthase epsilon chain, mitochondrial identical to ATP synthase epsilon chain, mitochondrial SP:Q96253 from [Arabidopsis thaliana] Length = 70 Score = 63.7 bits (148), Expect = 6e-11 Identities = 25/49 (51%), Positives = 37/49 (75%) Frame = +1 Query: 112 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRP 258 WR AG+TYI+YSNI A ++R LK+ +AEAL R++ H ++ WA+G+P Sbjct: 10 WRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKP 58 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 258 CTPPESCSKVKKE*LTNMHENHQLLIY 338 C PP SCSK+ + +T + HQ L++ Sbjct: 743 CPPPYSCSKLDND-VTEIRNEHQTLVF 768 >At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc finger domain-containing protein-related contains Pfam profiles PF03468: XS domain, weak hit to PF03470: XS zinc finger domain Length = 625 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 99 QNXRLEASWFNLHKLLKH-RSQGASQV 176 QN W+NLH LL H R++GA +V Sbjct: 232 QNGPGAIDWYNLHPLLAHARTKGARRV 258 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 282 WNSFLEVCRSSVGPRCDSDVRFVTFQRL 199 WNS +C+S VG C SD V RL Sbjct: 67 WNSTNHICKSWVGVTCTSDGTSVHALRL 94 >At3g14710.1 68416.m01860 F-box family protein ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 442 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 211 VSTPLLEILALVTCEAPWLRCLSSLCKLNQLASK 110 + +PLL I + C + + S +CK+ LASK Sbjct: 219 IDSPLLRIFEMFKCTSEHVPNPSQVCKIRVLASK 252 >At1g22370.2 68414.m09509 UDP-glucoronosyl/UDP-glucosyl transferase family protein glycosyltransferase family Length = 479 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 286 TLEQLSGGVQVVRWP 242 TLE LSGGV +V WP Sbjct: 381 TLESLSGGVPMVCWP 395 >At1g22370.1 68414.m09508 UDP-glucoronosyl/UDP-glucosyl transferase family protein glycosyltransferase family Length = 309 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 286 TLEQLSGGVQVVRWP 242 TLE LSGGV +V WP Sbjct: 211 TLESLSGGVPMVCWP 225 >At5g44960.1 68418.m05514 F-box family protein contains F-box domain Pfam:PF00646 Length = 416 Score = 26.6 bits (56), Expect = 7.8 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +1 Query: 40 VEFRXISIXFLXIKVNXHINKMXAWRQAGLTYINY----SNIAAKV-LRRSLKQEFRAEA 204 ++F + + HINK+ Q+G+ +NY S + K+ LR S +E+ Sbjct: 338 IDFHEVPQCLISTLEYVHINKLMMMEQSGIKLVNYFIENSAVLKKLTLRFSFFSSIESES 397 Query: 205 LKRDESHVRVTP 240 K+ + +++P Sbjct: 398 YKKLLTSTKLSP 409 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,950,733 Number of Sequences: 28952 Number of extensions: 117537 Number of successful extensions: 309 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -