BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I02 (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 1.2 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 8.5 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 103 KKQNGFNDIPXWVCSRWLPLSSTPKPL 183 K Q+GF I VCS +L S +PL Sbjct: 922 KTQDGFGPIHYGVCSNYLREISDGEPL 948 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/34 (20%), Positives = 14/34 (41%) Frame = +3 Query: 162 VFYAEAAGTCPLPSKVYGCSPKCKEDYECTHGKV 263 + + + G P P Y C +C + + K+ Sbjct: 35 IHFLQYPGCVPKPIPSYACRGRCSSYLQVSGSKI 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,176 Number of Sequences: 438 Number of extensions: 2395 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -