BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H24 (607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 4.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 8.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.1 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 526 HCTQPPLATLXATEET 573 +C PPL +L EET Sbjct: 89 YCLLPPLESLATVEET 104 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 337 SPPLRIPGLSISTLSGLVLFFLMTLLAFPQPP 242 SPP+ I +++ +SG++ L L P+ P Sbjct: 118 SPPMPITTDNVAAISGVLRSLLDRPLPAPERP 149 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 425 SRTFPSLLRRSLHRLGCHRLLENRSA 502 +RT PS LR + R L +RSA Sbjct: 23 TRTIPSFLRDDVERYPSGPELSDRSA 48 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 8.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 411 ISWSDPEPFPVYYV 452 + WS P+ P YY+ Sbjct: 292 LMWSKPDLIPNYYI 305 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,062 Number of Sequences: 336 Number of extensions: 2790 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -