BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H24 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27124| Best HMM Match : NHL (HMM E-Value=6.4e-17) 31 0.72 SB_51558| Best HMM Match : DSS1_SEM1 (HMM E-Value=0.2) 30 1.7 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_7118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) 28 5.1 SB_933| Best HMM Match : ExoD (HMM E-Value=6) 28 6.7 SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_45939| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00051) 27 8.9 SB_2980| Best HMM Match : DUF814 (HMM E-Value=2.10195e-44) 27 8.9 SB_36923| Best HMM Match : FlaC_arch (HMM E-Value=0.34) 27 8.9 SB_20027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_1743| Best HMM Match : DUF563 (HMM E-Value=3.7) 27 8.9 >SB_27124| Best HMM Match : NHL (HMM E-Value=6.4e-17) Length = 415 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 287 GSIFPDDALSVSPASNHHL-IHRIRFLRACRERDVGIIRCSDFEL 156 GSIF D VS NH L + R + L C+ER++G D EL Sbjct: 303 GSIFHDKTFIVSDLRNHVLRVFRQKGLTICKERNIGQRGGKDGEL 347 >SB_51558| Best HMM Match : DSS1_SEM1 (HMM E-Value=0.2) Length = 878 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 210 QESDPMYEVMIGGWGNAKSVIRKN-RTKPDKVEIESPGILNGG 335 Q+ D MYEV+I + +RK+ R+ D E E PGI+ GG Sbjct: 766 QQQDQMYEVLI------HNALRKSFRSDEDDDENEEPGIIRGG 802 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +1 Query: 355 FVGIAALSPLDARVKLFHSYLGLIPNLSQFTTSESAQAGVPQAPGKSKCHRLHLXQLHCT 534 F +LSP + FHS + + S + ++ ++ + S+ +H+ H T Sbjct: 2865 FHSFTSLSPKPSPKSSFHSCIDSSTDSSYHSVTQKSRLPSTTSSNSSRTSSIHVPSFHST 2924 Query: 535 QPPLA--TLXATEETY 576 QP A TL +T ++ Sbjct: 2925 QPANAPFTLPSTSRSF 2940 >SB_7118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 204 GPQESDPMYEVMIGGWGNAKSVIRKNRT-KPDKVEIESPGILNGGEY 341 GP + + +G W S R +T P KV + PGI NG Y Sbjct: 84 GPTQDCDVNSGEVGPWKEVPSCSRVGQTGDPSKVRVYGPGIENGLRY 130 >SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) Length = 225 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 300 VEIESPGILNGGEYRGFWVRWDSGIISAGREGEAIPFISWSDPEPFPV-YYV 452 + I + GI + + FWV + S + G I W+DP+P V YY+ Sbjct: 1 LNIATSGITSAEKRMVFWVDFRSANLVLGSGATVIA--QWTDPDPLEVGYYI 50 >SB_933| Best HMM Match : ExoD (HMM E-Value=6) Length = 555 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 292 PIRLKLKAPEFLTEGNIVVFGFVG-IAALSPLDARVKLFHSYLG 420 P ++ K P L +G I+ GF+G ++AL ++LF G Sbjct: 100 PYVIRPKGPRLLRQGTIMKAGFIGLVSALGVYACNLELFRRCAG 143 >SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 27.5 bits (58), Expect = 8.9 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +1 Query: 373 LSPLDARVKLFHSYLGLIPNLSQFTTSESAQAGVPQAPGKSKCHRLHLXQLHCTQPPLAT 552 ++P+ A +K H + +Q ++S + P ++ HRLHL L+C + T Sbjct: 300 INPIKAHIKKTHKVHSV--EKTQTAAADSNTSPGPLLTDTTEQHRLHLFDLNCR---ICT 354 Query: 553 LXATEETYPLRLEEP 597 P R EEP Sbjct: 355 GKMAPPGEPQRPEEP 369 >SB_45939| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00051) Length = 575 Score = 27.5 bits (58), Expect = 8.9 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = +3 Query: 231 EVMIGGWGNAKSVIRKNRTKPDKVEIESPGILNGGEYRGFWVRWDSGIISAGREGEAIPF 410 + + G +AKS+ + +P+K +IES LN + + +I AG + +A P Sbjct: 247 QCQLAGTRSAKSIYFGSYYRPNKSDIESLDELNSSLLKMGTTLHKNNVILAG-DFDA-PD 304 Query: 411 ISWSDPE 431 I W +PE Sbjct: 305 IDWVNPE 311 >SB_2980| Best HMM Match : DUF814 (HMM E-Value=2.10195e-44) Length = 950 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 252 GNAKSVIRKNRTKPDKVEIESPGILNGGEYRGFWVR 359 GNA VI P+ +E E PG L + R W R Sbjct: 784 GNAADVIDGAGAPPEGLEQEEPGPLRTAQSREAWTR 819 >SB_36923| Best HMM Match : FlaC_arch (HMM E-Value=0.34) Length = 240 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 363 DSGIISAGREGEAIPFISWSDPEPFPVYYVGVCTG 467 D G + G E I F+ WS + F VCTG Sbjct: 200 DKGNVKMGNELSDISFVLWSVEQEFASNAGAVCTG 234 >SB_20027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 470 PACA-DSDVVNWERFGIRPRYEWNSFTLASSGDNAAIPTNPKTT 342 P C ++ V + RP+ EW S ++ + D +A+P KTT Sbjct: 84 PTCTGNTPEVKCKTIVARPKREWASGSVPNEKDESALPDAIKTT 127 >SB_1743| Best HMM Match : DUF563 (HMM E-Value=3.7) Length = 249 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 284 SIFPDDALSVSPASNHHLIHRIRFLRAC 201 S+ P+ A+S++ S HH R FLR C Sbjct: 154 SLHPEVAMSLATYSLHHFTQRRFFLRRC 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,148,879 Number of Sequences: 59808 Number of extensions: 358050 Number of successful extensions: 1015 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -