BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H22 (593 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20360.1 68415.m02377 expressed protein 124 3e-29 At1g19540.1 68414.m02434 isoflavone reductase, putative similar ... 37 0.009 At1g75290.1 68414.m08746 isoflavone reductase, putative similar ... 33 0.14 At1g75280.1 68414.m08745 isoflavone reductase, putative identica... 33 0.14 At2g44040.1 68415.m05475 dihydrodipicolinate reductase family pr... 32 0.25 At1g75300.1 68414.m08747 isoflavone reductase, putative identica... 32 0.25 At2g45310.1 68415.m05639 NAD-dependent epimerase/dehydratase fam... 31 0.77 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 29 1.8 At3g59890.2 68416.m06683 dihydrodipicolinate reductase family pr... 29 1.8 At3g59890.1 68416.m06684 dihydrodipicolinate reductase family pr... 29 1.8 At3g03980.1 68416.m00419 short-chain dehydrogenase/reductase (SD... 29 2.3 At2g34070.1 68415.m04171 expressed protein 29 3.1 At5g19060.1 68418.m02266 expressed protein ; expression supporte... 28 4.1 At4g11370.1 68417.m01833 zinc finger (C3HC4-type RING finger) fa... 28 4.1 At3g46810.1 68416.m05081 DC1 domain-containing protein contains ... 28 5.4 At1g02000.1 68414.m00118 NAD-dependent epimerase/dehydratase fam... 28 5.4 At5g54960.1 68418.m06845 pyruvate decarboxylase, putative strong... 27 9.4 At5g50310.1 68418.m06229 kelch repeat-containing protein similar... 27 9.4 At5g44400.1 68418.m05436 FAD-binding domain-containing protein s... 27 9.4 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 27 9.4 At4g19170.1 68417.m02829 9-cis-epoxycarotenoid dioxygenase, puta... 27 9.4 >At2g20360.1 68415.m02377 expressed protein Length = 402 Score = 124 bits (300), Expect = 3e-29 Identities = 62/141 (43%), Positives = 97/141 (68%) Frame = +2 Query: 167 HLNGSMSVVYIKAANYSSDRKPNLAAYKRGTGGRSSFNGIVATVFGCTGFVGRYVCNKLG 346 HLNG+ + Y +++ ++ +LA ++GTGGRSS +GIVATVFG TGF+GRY+ +L Sbjct: 34 HLNGTDNCRY--SSSLATKGVGHLA--RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA 89 Query: 347 KIGTQLILPYRGDFYDAQRLKVCGDLGQVLFTPYHLLDEESIAKAVRYSNVVINLVGRDY 526 K+G+Q+++P+RG + LK+ GDLGQV+ + DE+SI + +NVVINL+GR+Y Sbjct: 90 KMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREY 149 Query: 527 ETKNFKYNDVHVDGVRRIAXI 589 ET+NF + D + ++A + Sbjct: 150 ETRNFSFEDANHHIAEKLALV 170 >At1g19540.1 68414.m02434 isoflavone reductase, putative similar to SP|P52577; contains isoflavone reductase domain PF02716 Length = 310 Score = 37.1 bits (82), Expect = 0.009 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 4/97 (4%) Frame = +2 Query: 296 VFGCTGFVGRYVCNKLGKIGTQLILPYR----GDFYDAQRLKVCGDLGQVLFTPYHLLDE 463 V G TG +G+ + + K G R D AQ ++ DLG + L D+ Sbjct: 7 VIGATGLIGKVLVEESAKSGHATFALVREASLSDPVKAQLVERFKDLGVTILYG-SLSDK 65 Query: 464 ESIAKAVRYSNVVINLVGRDYETKNFKYNDVHVDGVR 574 ES+ KA++ +VVI+ VGR ++T+ ++ +D ++ Sbjct: 66 ESLVKAIKQVDVVISAVGR-FQTEILNQTNI-IDAIK 100 >At1g75290.1 68414.m08746 isoflavone reductase, putative similar to SP|P52577 Isoflavone reductase homolog P3 (EC 1.3.1.-) {Arabidopsis thaliana}; contains Pfam profile PF02716: Isoflavone reductase Length = 323 Score = 33.1 bits (72), Expect = 0.14 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +2 Query: 296 VFGCTGFVGRYVCNKLGKIG-TQLILPYRGDFYDAQRLKVCGDLGQVLFTPYH--LLDEE 466 V G TG +G+ + K G + L L D + K + T H L D E Sbjct: 10 VIGGTGHIGKLIIEASVKAGHSTLALVREASLSDPNKGKTVQNFKDFGVTLLHGDLNDHE 69 Query: 467 SIAKAVRYSNVVINLVG 517 S+ KA++ ++VVI+ VG Sbjct: 70 SLVKAIKQADVVISTVG 86 >At1g75280.1 68414.m08745 isoflavone reductase, putative identical to SP|P52577 Isoflavone reductase homolog P3 (EC 1.3.1.-) {Arabidopsis thaliana}; contains Pfam profile PF02716: isoflavone reductase Length = 310 Score = 33.1 bits (72), Expect = 0.14 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +2 Query: 296 VFGCTGFVGRYVCNKLGKIG-TQLILPYRGDFYDAQRLKVCGDLGQVLFTPYH--LLDEE 466 V G TG++G+++ K G + L D + K + T H L D E Sbjct: 10 VIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHE 69 Query: 467 SIAKAVRYSNVVINLVG 517 S+ KA++ +VVI+ VG Sbjct: 70 SLVKAIKQVDVVISTVG 86 >At2g44040.1 68415.m05475 dihydrodipicolinate reductase family protein weak similarity to SP|Q52419 Dihydrodipicolinate reductase (EC 1.3.1.26) (DHPR) {Pseudomonas syringae} ; contains Pfam profiles PF01113: Dihydrodipicolinate reductase N-terminus, PF05173: Dihydrodipicolinate reductase C-terminus Length = 347 Score = 32.3 bits (70), Expect = 0.25 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +2 Query: 278 NGIVATVFGCTGFVGRYVCNKLGKIGTQLI-LPYRGDFYDAQRLKVCG 418 NGI V GC+G +G+ V G ++ + + D QR++VCG Sbjct: 71 NGISIMVNGCSGKMGKAVIKAADSAGVNIVPISFGSAGEDGQRVEVCG 118 >At1g75300.1 68414.m08747 isoflavone reductase, putative identical to SP|P52577 Isoflavone reductase homolog P3 (EC 1.3.1.-) {Arabidopsis thaliana}; contains Pfam profile PF02716: Isoflavone reductase Length = 322 Score = 32.3 bits (70), Expect = 0.25 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +2 Query: 296 VFGCTGFVGRYVCNKLGKIGTQLILPYR----GDFYDAQRLKVCGDLGQVLFTPYHLLDE 463 V G TG++G ++ K G R D ++ ++ DLG V L D Sbjct: 10 VIGGTGYMGEFIVEGSAKAGNPTFALVREASLSDPVKSKTIQSFKDLG-VTILHGDLNDH 68 Query: 464 ESIAKAVRYSNVVINLVG 517 ES+ KA++ +VVI+ +G Sbjct: 69 ESLVKAIKQVDVVISTIG 86 >At2g45310.1 68415.m05639 NAD-dependent epimerase/dehydratase family protein similar to nucleotide sugar epimerase from Vibrio vulnificus GI:3093975 [PID:g3093975], WbnF [Escherichia coli] GI:5739472, CAPI protein {Staphylococcus aureus} SP|P39858; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 437 Score = 30.7 bits (66), Expect = 0.77 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 269 SSFNGIVATVFGCTGFVGRYVCNKLGKIGTQLI-LPYRGDFYD 394 S+ NGI V G GFVG +V L + G +I L D+YD Sbjct: 92 STNNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYD 134 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 29.5 bits (63), Expect = 1.8 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 7/100 (7%) Frame = +2 Query: 176 GSMSVVYIKAANYSSDRKPNLAAYKRGTGGRSSFNGIV---ATVFGCTGFVGRYVCNKLG 346 G+ S++++ + +Y+ R N + + GG FNG+V G G Y + Sbjct: 200 GASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNIS 259 Query: 347 KIGTQLILPYRG---DFYDAQR-LKVCGDLGQVLFTPYHL 454 G I+ YRG YD+ + + + GDL F + L Sbjct: 260 CAG---IIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFAL 296 >At3g59890.2 68416.m06683 dihydrodipicolinate reductase family protein weak similarity to SP|Q52419 Dihydrodipicolinate reductase (EC 1.3.1.26) (DHPR) {Pseudomonas syringae}; contains Pfam profiles PF01113: Dihydrodipicolinate reductase N-terminus, PF05173: Dihydrodipicolinate reductase C-terminus Length = 343 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 278 NGIVATVFGCTGFVGRYVCNKLGKIGTQLILPYRGDFYDA-QRLKVCG 418 NGI V GC+G +G+ V G ++ G +A Q ++VCG Sbjct: 67 NGISIMVNGCSGKMGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCG 114 >At3g59890.1 68416.m06684 dihydrodipicolinate reductase family protein weak similarity to SP|Q52419 Dihydrodipicolinate reductase (EC 1.3.1.26) (DHPR) {Pseudomonas syringae}; contains Pfam profiles PF01113: Dihydrodipicolinate reductase N-terminus, PF05173: Dihydrodipicolinate reductase C-terminus Length = 349 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 278 NGIVATVFGCTGFVGRYVCNKLGKIGTQLILPYRGDFYDA-QRLKVCG 418 NGI V GC+G +G+ V G ++ G +A Q ++VCG Sbjct: 73 NGISIMVNGCSGKMGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCG 120 >At3g03980.1 68416.m00419 short-chain dehydrogenase/reductase (SDR) family protein similar to short-chain type dehydrogenase/reductase SP:Q08632 [Picea abies] Length = 270 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 281 GIVATVFGCTGFVGRYVCNKLGKIGTQLILPYRGDFYDAQRL 406 G VA V G + +GR + L ++G ++++ Y DA+R+ Sbjct: 16 GRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERV 57 >At2g34070.1 68415.m04171 expressed protein Length = 385 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 170 LNGS-MSVVYIKAANYSSDRKPNLAAYKRGTGGRSSFNGIVATVFGCTGFVGRYV 331 L+G+ ++ Y+K + S K LAA GG+ G T GC F GR+V Sbjct: 20 LSGADQALAYVKKPHVSQRNKTALAAVAGRGGGKEMLKGRKQT-SGCNLFQGRWV 73 >At5g19060.1 68418.m02266 expressed protein ; expression supported by MPSS Length = 551 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 287 RCR*SYCGHQYLAYMLQGWVYDPNCS*RL 201 RCR +C A GWVY +CS +L Sbjct: 272 RCREPWCDGALSALESNGWVYSSHCSFKL 300 >At4g11370.1 68417.m01833 zinc finger (C3HC4-type RING finger) family protein strong similarity to RING-H2 finger protein RHA1a [Arabidopsis thaliana] GI:3790554; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 159 Score = 28.3 bits (60), Expect = 4.1 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 2/81 (2%) Frame = -1 Query: 452 DGKE*TGPGLNLRTLSTFGHHRNRLC-MVKLTGYQFFPI-CCTHSVRQIRCNRKLWLRCR 279 D E + P L LST N L +V+ + P CCT + + K+ + Sbjct: 45 DHNETSAPDLTRHALSTSASLANELIPVVRFSDLPTDPEDCCTVCLSDFESDDKVRQLPK 104 Query: 278 *SYCGHQYLAYMLQGWVYDPN 216 CGH + Y L W+ D N Sbjct: 105 ---CGHVFHHYCLDRWIVDYN 122 >At3g46810.1 68416.m05081 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 686 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/66 (24%), Positives = 28/66 (42%) Frame = +2 Query: 311 GFVGRYVCNKLGKIGTQLILPYRGDFYDAQRLKVCGDLGQVLFTPYHLLDEESIAKAVRY 490 GF G Y C+K + R D +D L+ G + P+ ++DE +I Sbjct: 328 GFYGAYSCSKCSSYVVHSLCATRKDVWDMVELE--GTPEEEEIAPFEVVDENTIKHMSHD 385 Query: 491 SNVVIN 508 +++ N Sbjct: 386 HDLIFN 391 >At1g02000.1 68414.m00118 NAD-dependent epimerase/dehydratase family protein similar to nucleotide sugar epimerase from Vibrio vulnificus GI:3093975 [PID:g3093975], WbnF [Escherichia coli] GI:5739472, CAPI protein {Staphylococcus aureus} SP|P39858; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 434 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 278 NGIVATVFGCTGFVGRYVCNKLGKIGTQLI-LPYRGDFYD 394 NG+ V G GFVG +V L + G ++ L D+YD Sbjct: 90 NGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYD 129 >At5g54960.1 68418.m06845 pyruvate decarboxylase, putative strong similarity to pyruvate decarboxylase 1 [Vitis vinifera] GI:10732644; contains InterPro entry IPR000399: Pyruvate decarboxylase Length = 607 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 293 TVFGCTGFVGRYVCNKLGKIGTQLILPYRGDF 388 TV C +GRY+ +L +IG + GDF Sbjct: 39 TVSPCDATLGRYLARRLVEIGVTDVFSVPGDF 70 >At5g50310.1 68418.m06229 kelch repeat-containing protein similar to Kelch repeats protein 3 (SP:Q08979) [Saccharomyces cerevisiae]; contains Pfam PF01344: Kelch motif (6 repeats) Length = 666 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 356 TQLILPYRGDFYDAQRLKVCGDL 424 T+LIL Y G+FY+ Q+ V GDL Sbjct: 82 TELIL-YGGEFYNGQKTYVYGDL 103 >At5g44400.1 68418.m05436 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 537 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 359 GYQFFPICCTHSVRQIRCNRKLWLRCR*SYCGHQY--LAYMLQ 237 G+ F PI +H I C++KL + R GH Y L+Y+ Q Sbjct: 85 GFIFSPIHESHVQASIICSKKLRMHLRVRSGGHDYEGLSYVSQ 127 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/68 (23%), Positives = 29/68 (42%) Frame = +2 Query: 176 GSMSVVYIKAANYSSDRKPNLAAYKRGTGGRSSFNGIVATVFGCTGFVGRYVCNKLGKIG 355 G+M++ K + N A + G G + S N + TGF G ++G G Sbjct: 506 GTMTMKRKKPCDAGERTSANCANNETGNGKKVSVNNVGEAEPADTGFTGLTDNLRIGSFG 565 Query: 356 TQLILPYR 379 ++++ R Sbjct: 566 NEVVIELR 573 >At4g19170.1 68417.m02829 9-cis-epoxycarotenoid dioxygenase, putative / neoxanthin cleavage enzyme, putative / carotenoid cleavage dioxygenase, putative similar to 9-cis-epoxycarotenoid dioxygenase [Phaseolus vulgaris][GI:6715257]; neoxanthin cleavage enzyme, Lycopersicon esculentum, PATX:E325797 Length = 595 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 443 PYHLLDEESIAKAVRYSNVVINLVGRDYETKNFKYN 550 PYHL D + + A++ N L R K +KYN Sbjct: 156 PYHLFDGDGMLHAIKIHNGKATLCSR--YVKTYKYN 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,604,190 Number of Sequences: 28952 Number of extensions: 224470 Number of successful extensions: 513 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -