BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H21 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 32 0.32 SB_20363| Best HMM Match : Involucrin (HMM E-Value=0.31) 31 0.74 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 31 0.74 SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) 29 3.9 SB_19450| Best HMM Match : GTP_EFTU (HMM E-Value=7.9e-08) 29 3.9 SB_9946| Best HMM Match : IQ (HMM E-Value=0.00018) 28 5.2 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 28 6.9 SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) 27 9.1 >SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 83.8 bits (198), Expect = 1e-16 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = +3 Query: 453 EHPKFNFVGKLLGPKGNTMKQLQEDTLCKMAVLGRGSMRDRQKEEELRQSLXP 611 +HPKFNFVGKLLGP+GNT K+LQ T KM++LG+GSMRD++KEEELR + P Sbjct: 111 DHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKEKEEELRATEDP 163 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 56.4 bits (130), Expect = 2e-08 Identities = 27/93 (29%), Positives = 50/93 (53%) Frame = +3 Query: 294 KLNNSKFPLSMKLIDQEVTKVQASGRITKDSKYVDVFRDXXXXXXXXXXXXXXEHPKFNF 473 +LN F + +L D+ +Q +I D K ++ E+P+ NF Sbjct: 58 RLNTRDFRVRKRLEDERHKFIQDMMKINPDFKPPADYKPPLIKIQDKVMIPQDENPEVNF 117 Query: 474 VGKLLGPKGNTMKQLQEDTLCKMAVLGRGSMRD 572 +G L+GP+GNT+K ++++T K+ + G+GS++D Sbjct: 118 IGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKD 150 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 32.3 bits (70), Expect = 0.32 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = +3 Query: 180 KRNTTQGKPEELDQNGEEGIKIN---EKAGEYMR-ELLSEKIKLNNSKFPLSMKLIDQEV 347 KR + K E++Q EE EK E MR E E++K + +KF +M + + +V Sbjct: 423 KRGCEEEKDSEIEQLREELRTTRDDFEKECERMRGEFQEERVK-DYAKFCTAMAVRNAQV 481 Query: 348 TKVQASGRITKDSKYVDVFRD 410 ++Q + +T K ++VFR+ Sbjct: 482 LEIQRAELLTDHEKEMEVFRE 502 >SB_20363| Best HMM Match : Involucrin (HMM E-Value=0.31) Length = 353 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 141 DKYDKNGYNSGDFKRNTTQGKPEELDQNGEEGIKINE 251 D NG+ SGD + ++T GKP + + E G KI + Sbjct: 11 DDSKANGHMSGDSQSSSTSGKPSQQESQTELGQKIEK 47 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 141 DKYDKNGYNSGDFKRNTTQGKPEELDQNGEEGIKINE 251 D NG+ SGD + ++T GKP + + E G KI + Sbjct: 289 DDSKANGHMSGDSQSSSTSGKPSQQESQTELGQKIEK 325 >SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 29.5 bits (63), Expect = 2.2 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 6/98 (6%) Frame = +3 Query: 120 FDLIKMADKYDKNGYNSGDFKRNTTQGK-PEELDQN---GEEGIKINEKAGEYMRELLSE 287 F + YD G S D ++ TT+GK PE + +N G G + E + + + SE Sbjct: 659 FQTLDRKGGYDNPGQASDDDEKETTRGKAPEPIYENTKDGRCGSAVYENSNVALEAVTSE 718 Query: 288 KIKLNNSK-FPLS-MKLIDQEVTKVQASGRITKDSKYV 395 + L K F LS +L +EV V + + YV Sbjct: 719 GVGLAQVKCFNLSPEELESREVIPVDIAFDELPEKYYV 756 >SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) Length = 1064 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 309 KFPLSMKLIDQEVTKVQASGRITKDSK 389 K+ L M L+++ +T+V A GRIT+D + Sbjct: 764 KYGLRMSLLERLMTRVAAYGRITEDEE 790 >SB_19450| Best HMM Match : GTP_EFTU (HMM E-Value=7.9e-08) Length = 926 Score = 28.7 bits (61), Expect = 3.9 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = +3 Query: 150 DKNGYNSGDFKRNTTQGKPEELDQN-GEEGIKINEKAG-EYMREL-LSEKIKLNNSKFPL 320 D NGYN + NT Q + E +K+ A Y ++ I NN+ P+ Sbjct: 502 DMNGYNEVAARNNTAQALSTAIKLRVNNEFVKVTVDAWYRYSASFQMAGVITANNTSTPV 561 Query: 321 SMKLIDQEVTKVQASGRITK 380 S +I E KV A R K Sbjct: 562 SRSIISLEGQKVLAVRRSKK 581 >SB_9946| Best HMM Match : IQ (HMM E-Value=0.00018) Length = 786 Score = 28.3 bits (60), Expect = 5.2 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 135 MADKYDKNGYNSGDFKRNTTQGKPEELDQNGEEGIKINEKAGEYMRELLSEKI-KLNNSK 311 +A+ D + G+ + TQ EE+ Q E +K E+ R+ E++ K K Sbjct: 310 LAESLDPIFFVLGNQSNSETQEDLEEMRQ--AEKVKRREEKARLARQAAIEELQKKREEK 367 Query: 312 FPLSMKLIDQEVTKVQASGRITK 380 + + + E+ +QASG+++K Sbjct: 368 KQENQRKAEDEMKFLQASGKVSK 390 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 27.9 bits (59), Expect = 6.9 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 5/99 (5%) Frame = +3 Query: 123 DLI-KMADKYDKNGYN--SGDFKRNTTQGKPEELDQNGEEGIKINEKAGEYMRE--LLSE 287 DLI KMA+ K + + +N + +ELD + + EK MRE LL + Sbjct: 1099 DLISKMAEYEGKISKHETTSSLAQNRMKEAHQELDTIKRDAKPLMEKYESTMREYELLKD 1158 Query: 288 KIKLNNSKFPLSMKLIDQEVTKVQASGRITKDSKYVDVF 404 +++ SK + +D+E+ K +A + +D K D++ Sbjct: 1159 EVEQLRSKLSTTELQLDEEIRKRKALQK-ERDDKAEDLY 1196 >SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) Length = 283 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 327 KLIDQEVTKVQASGRITKDS 386 KLID+E+TK+++ G I+K S Sbjct: 55 KLIDEEITKLKSKGAISKVS 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,662,431 Number of Sequences: 59808 Number of extensions: 304189 Number of successful extensions: 862 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -