BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H19 (573 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 24 1.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 3.2 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 5.6 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 9.9 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 9.9 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 112 QHLVGXTVFGVAHIFASFNDTFVHVTDLSGRETI 213 +H+VG V V ++ SFN T +V D RE I Sbjct: 21 EHMVGTIVVVVRGVWVSFNQTAQNV-DTFVREQI 53 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 3.2 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 312 NSWHNGLAHKAPCYWWKQN 368 N WHN + + +W K N Sbjct: 374 NRWHNNNGNNSNNHWRKNN 392 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 170 SLNEAKMCATPNTVXPTK 117 ++NE + C+TP PTK Sbjct: 427 NVNENQDCSTPTENSPTK 444 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 104 SGPSI*WAXQCLV*HTFSLHSMTHSFML 187 S P+I W QC+ + F ++ +++L Sbjct: 194 SHPNITWYQQCVTYNVFPTYAHELTYLL 221 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 104 SGPSI*WAXQCLV*HTFSLHSMTHSFML 187 S P+I W QC+ + F ++ +++L Sbjct: 194 SHPNITWYQQCVTYNVFPTYAHELTYLL 221 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,670 Number of Sequences: 336 Number of extensions: 2680 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -