BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H17 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 28 0.082 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 3.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 7.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 7.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.4 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.4 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 28.3 bits (60), Expect = 0.082 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 141 DKYDKNGYNSGDFKRNTTQGKPEELDQNGEEGIKINEKAGEYMRELLSEKIKL 299 +KY+KNG K++ + P ++ E N++ GE M ++E +L Sbjct: 164 EKYEKNGETYLRIKKHAVKFNPAKVKLRFENLFDGNKELGEQMNRFINENSEL 216 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 126 LIKMADKYDKNGYNSGDF 179 LIK++D ++ YN+GD+ Sbjct: 229 LIKISDVLEETFYNNGDY 246 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 716 FFDFCKCICNSSVSLCWWCYGRYLNMK 636 +FD C + N++V++ + G YL +K Sbjct: 464 YFDKCDTLINNAVAVENFKGGMYLRLK 490 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 716 FFDFCKCICNSSVSLCWWCYGRYLNMK 636 +FD C + N++V++ + G YL +K Sbjct: 464 YFDKCDTLINNAVAVENFKGGMYLRLK 490 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 704 CKCICNSSVSLC 669 CKCI S++LC Sbjct: 183 CKCIYVQSINLC 194 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 541 WLYSAGAQ*ETGKKKKNS 594 W+Y + A E G KKK + Sbjct: 199 WVYKSKASEEHGNKKKKN 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,156 Number of Sequences: 438 Number of extensions: 3884 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -