BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H16 (666 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal prote... 92 3e-19 Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical pr... 31 0.73 >U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal protein, large subunitprotein 6 protein. Length = 217 Score = 92.3 bits (219), Expect = 3e-19 Identities = 45/79 (56%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = +1 Query: 367 IRPNLKIGTVCILLAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTS 543 +R L GTV I+LAGRH GKRVV + LP SGLLLVTGP N PLRRI Q +VI TS Sbjct: 67 LRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATS 126 Query: 544 TRISLGNFKLPKHFNDDYF 600 ++++ K+P+H ND+YF Sbjct: 127 LKVNVSGVKIPEHINDEYF 145 >Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical protein C54C8.12 protein. Length = 82 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 298 FYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKR 432 FYPT+ +A S G P + PN ++ V A RHAG R Sbjct: 26 FYPTEISTKARSHGHPVNTLGESEDPNFQVDNVPGERARRHAGPR 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,432,148 Number of Sequences: 27780 Number of extensions: 271677 Number of successful extensions: 660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -