BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H16 (666 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 94 9e-20 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 94 9e-20 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 90 1e-18 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 1.6 At5g08320.1 68418.m00979 expressed protein predicted proteins, H... 29 3.7 At2g27270.1 68415.m03277 expressed protein 28 4.9 At1g20540.1 68414.m02559 transducin family protein / WD-40 repea... 28 6.4 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 93.9 bits (223), Expect = 9e-20 Identities = 50/108 (46%), Positives = 69/108 (63%) Frame = +1 Query: 277 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 456 P+++ FYP ++ ++ R +K + +R ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPPKFYPAED-VKKPLPNRRTAKPAK-LRASITPGTVLIILAGRFKGKRVVFLKQLA 114 Query: 457 SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYF 600 SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F+D YF Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYF 161 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 93.9 bits (223), Expect = 9e-20 Identities = 50/108 (46%), Positives = 69/108 (63%) Frame = +1 Query: 277 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 456 P+++ FYP ++ ++ R +K + +R ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPPKFYPAED-VKKPLPNRRTAKPTK-LRASITPGTVLIILAGRFKGKRVVFLKQLA 114 Query: 457 SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYF 600 SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F+D YF Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYF 161 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 89.8 bits (213), Expect = 1e-18 Identities = 49/108 (45%), Positives = 67/108 (62%) Frame = +1 Query: 277 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 456 P+++ FYP ++ ++ R K + ++ ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPAKFYPAED-VKKPLVNRRKPKPTK-LKASITPGTVLIILAGRFKGKRVVFLKQLS 114 Query: 457 SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYF 600 SGLLLVTGPF N PLRR+ Q YVIGTST+I + K F+D YF Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEK-FDDKYF 161 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 277 PLKRRKSFYPTQEKIRASSGGRPFS-KHVRR 366 P++RR+S P +E++ S GGR S H+++ Sbjct: 525 PVRRRRSLTPDEERVSLSQGGRHTSPSHIKQ 555 >At5g08320.1 68418.m00979 expressed protein predicted proteins, Homo sapiens and Caenorhabditis elegans Length = 150 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -1 Query: 540 GADHIALRNTA*RARIESKRSSN*KQTAGQNSNKYNPLACMSTSEE 403 G D + +NT + +R S ++T ++S K NP+ C + S E Sbjct: 85 GTDTVLQQNTMPLKVGKRRRDSEMQETGSEDSEKVNPVFCSACSTE 130 >At2g27270.1 68415.m03277 expressed protein Length = 231 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 304 PTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 483 PT++K A G SKH R + + + C+ GK ++ G+ + +LL+ Sbjct: 21 PTKKKTEAKEEGAAASKHSRVVYSD---KSRCL----SKNGKTIIYFGVPAALILLIICV 73 Query: 484 FAFNSCPLR-RIPQ 522 FAFN ++ R+P+ Sbjct: 74 FAFNYIAIQPRVPR 87 >At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Rbap46 polypeptide (GI:9454362) [Gallus gallus] Length = 351 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 243 WR*EEWGNQNSTPQT*EV--LLPHSGENPCFIWWPS 344 W+ E Q ++PQ V L H G+ C +WWPS Sbjct: 96 WQIPELYGQLNSPQLERVASLDAHVGKINCVLWWPS 131 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,824,032 Number of Sequences: 28952 Number of extensions: 259076 Number of successful extensions: 629 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -