BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H12 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 0.85 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 22 3.4 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.9 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.2 bits (50), Expect = 0.85 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 498 ELVRIRVERYEYLVAEFVREVLPKDLHVLS 409 E+VR++ YE + E V P DL +L+ Sbjct: 344 EVVRVKKPHYELNMVEVRSPVTPADLRLLT 373 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 278 LVDCWCCRLKFCR 240 L +C+CCR F R Sbjct: 78 LKECYCCRESFLR 90 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 227 YSKXTYRISTDSTSSP 274 Y K +ST STSSP Sbjct: 188 YIKPQLHVSTGSTSSP 203 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,783 Number of Sequences: 336 Number of extensions: 2654 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -