BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H12 (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 3.2 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 5.7 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 7.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.9 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 374 AAGQVTTCCTSKLRTWRSFGRTSR 445 AAG V S+LR W+ F +R Sbjct: 445 AAGVVAPLLASRLREWKPFSEPTR 468 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 5.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 241 GALRIYHREFGR 206 G+ R+YHR FGR Sbjct: 226 GSFRVYHRCFGR 237 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 157 FALFARLTHLDXQPXQALLHD 95 F L THL + QALLH+ Sbjct: 47 FVLSDEFTHLRPEQRQALLHE 67 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 7.5 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +3 Query: 393 PAVRPSSEHGGPLAGLLAQTRRPSTHTAQHVYEPVPRSQEKNRETWSQTRGLR 551 P RPS GP + A TRR H Q RS K W + G R Sbjct: 1143 PTFRPSGPAMGPRTAMAAGTRR--AHVLQ-------RSAGKMFHQWGEALGAR 1186 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 9.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 387 SRPAVRPSSEHGGPLAGLLAQTRRPSTHTAQHVYEPVPRSQ 509 S+ + SS HGGP +++ T PS +A P Q Sbjct: 1339 SQSSHHSSSSHGGPTPSIISHT--PSLSSASGSIGPKSADQ 1377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,204 Number of Sequences: 2352 Number of extensions: 12155 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -