BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H09 (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 26 1.1 AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. 25 2.5 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 25 2.5 DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 24 4.4 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 26.2 bits (55), Expect = 1.1 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = -1 Query: 730 IXRITCSVIVLHKFQVIVVLIPNSLQLKSRLQKCHSRQLSYQQSLIGSHPLLVLRYPLVY 551 + I+ + I L ++QVIV +SLQL + + S++ + P+ ++R + Y Sbjct: 129 VSTISITAIALDRYQVIVYPTRDSLQLMGAIAILTGIWII---SIVLASPMFIIRQLIHY 185 Query: 550 SYNMEDL 530 N+ L Sbjct: 186 DVNLPSL 192 >AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. Length = 99 Score = 25.0 bits (52), Expect = 2.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 140 RNLSTAEKCSTTFHW 184 + ++ E+CS TFHW Sbjct: 66 QEVTVVERCSCTFHW 80 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -3 Query: 350 CPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFCLTXSNSCGPKYFGCN-KIXC 186 C + P + + T T P PST+ +++ +CG + N ++ C Sbjct: 286 CEVAVEPPAMTTTTTTTTTTPTTATACPSTTEFNYKELNCQNCGRLFISNNGRVSC 341 >DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 85 Score = 24.2 bits (50), Expect = 4.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 56 ACSVARCCCFCLFLKNHNXTNLIAWXPHRNL 148 A V +C C FL+N N + AW + NL Sbjct: 55 AACVDKCFCKDGFLRNENGKCVRAWHCNPNL 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,873 Number of Sequences: 2352 Number of extensions: 17846 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -