BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H06 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0413 - 3107668-3107796,3107879-3107971,3108082-3108253,310... 34 0.085 05_06_0276 + 26878732-26879574,26879920-26880387,26880800-268810... 31 0.80 05_01_0464 - 3670397-3670525,3671152-3671244,3671366-3671537,367... 31 1.1 02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362... 31 1.1 05_04_0131 + 18290201-18290650,18291474-18291626,18291950-182920... 30 1.8 08_01_0874 + 8575718-8576422,8576603-8576662,8576799-8576945,857... 29 4.2 09_04_0506 - 18188785-18190599 28 5.6 05_06_0277 + 26885621-26886064,26886148-26886317,26887038-268879... 28 5.6 02_02_0637 - 12491706-12492575,12492580-12492657 28 5.6 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 28 7.4 02_05_0288 - 27549718-27549940,27550025-27550102,27550282-275506... 28 7.4 08_02_0377 + 16481232-16481361,16482501-16482547,16482634-164827... 27 9.8 07_03_1389 + 26212117-26212119,26212721-26212875,26213402-262134... 27 9.8 07_01_0543 + 4008439-4008808,4009209-4009274,4009409-4009584 27 9.8 06_01_0234 - 1784498-1784770 27 9.8 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 27 9.8 03_06_0533 + 34565062-34565439 27 9.8 >01_01_0413 - 3107668-3107796,3107879-3107971,3108082-3108253, 3108341-3108417,3108514-3108673,3108766-3108875, 3109384-3109443,3109545-3109618,3109748-3109871, 3110795-3110872,3111169-3111275,3112572-3112673, 3112800-3112815 Length = 433 Score = 34.3 bits (75), Expect = 0.085 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 244 ASAA*STVRLVPSD-SKREYCPTTLSPTRVSCWLLTSPVWGSD 119 +S A T+ L S+ K++Y P+ T V CW LT P GSD Sbjct: 135 SSLAMVTIALCGSEVQKQKYLPSLAQLTAVGCWALTEPNHGSD 177 >05_06_0276 + 26878732-26879574,26879920-26880387,26880800-26881021, 26881153-26881278,26881309-26881573,26881719-26881936 Length = 713 Score = 31.1 bits (67), Expect = 0.80 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Frame = -1 Query: 438 PKERHRPTKLRDRNPSERHEQQRLSGLQERS--QRN-EPRARPPQS---GPERECVQERG 277 P+ R R R R+P R + S +ERS +RN PR P +S P+R+ V+E+ Sbjct: 30 PRRRERSPAARSRSPRRRSPVKSTSSHRERSPVRRNGSPRRSPVRSIGRSPQRDRVKEQV 89 Query: 276 PCARRR*IQSEHQQRSRQ 223 ++ +S R R+ Sbjct: 90 RSPKQSWSRSPSPARKRE 107 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/69 (28%), Positives = 24/69 (34%) Frame = -1 Query: 390 ERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSRQCA*Y 211 ER E R SG R PP+ + R P RR ++S R R Sbjct: 6 ERREHSRRSGRSRSRSPARDRGSPPRRRERSPAARSRSP-RRRSPVKSTSSHRERSPVRR 64 Query: 210 RQIPRESTV 184 PR S V Sbjct: 65 NGSPRRSPV 73 >05_01_0464 - 3670397-3670525,3671152-3671244,3671366-3671537, 3671626-3671702,3671819-3671978,3672104-3672213, 3672321-3672380,3672492-3672629,3672922-3672999, 3673227-3673333,3674506-3674598,3674708-3674723 Length = 410 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 199 KREYCPTTLSPTRVSCWLLTSPVWGSD 119 K++Y P+ + CW LT P +GSD Sbjct: 128 KQKYLPSLTQFRTIGCWALTEPDYGSD 154 >02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147, 3626311-3626479,3626701-3626871,3626948-3627016, 3627094-3627201,3627844-3627997,3628659-3628738, 3628822-3628914,3628951-3629073,3629165-3629915, 3630123-3630163,3630338-3630385 Length = 1038 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 441 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQ 313 S ER + RDR+P +H + R G ERS R+ R+R P+ Sbjct: 204 SEHERRGLSHERDRSPYMQHSRSRSRGRDERS-RSRSRSRSPR 245 >05_04_0131 + 18290201-18290650,18291474-18291626,18291950-18292042, 18292285-18292313,18292702-18292795,18292941-18293153 Length = 343 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 426 HRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERE 295 HR T+++ + SE E R S +E+ + N+P PP + E E Sbjct: 83 HRSTEVQPADDSEPEETSR-STTEEKKEENKPDETPPSTVTEPE 125 >08_01_0874 + 8575718-8576422,8576603-8576662,8576799-8576945, 8577390-8577527 Length = 349 Score = 28.7 bits (61), Expect = 4.2 Identities = 25/84 (29%), Positives = 33/84 (39%), Gaps = 4/84 (4%) Frame = -2 Query: 461 SDGSVSVAQRSAIGQ-RSSVTVTQVSAMSNNG*VGYRSDHSGMSQGRDHRRV---GQNGS 294 S GS+S + RS Q SV T+ +N RSD G S HRR G G Sbjct: 135 SAGSLSSSSRSISRQLHRSVPKTRKDGGTNGSNARMRSDSGGNSGANVHRRADLQGPTGR 194 Query: 293 VYKSGVLAHDGVESRVSISSVVDS 222 +L H +S + +S Sbjct: 195 FVSQSLLRHRSRNQEEPVSHLENS 218 >09_04_0506 - 18188785-18190599 Length = 604 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 390 ERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSR 226 ER ++ SG +R + E PP PER ER R + ++R R Sbjct: 481 ERPPEREWSGASDRRREREKDLPPPPDWPERRHRDERDAGRERERERDRDRERER 535 >05_06_0277 + 26885621-26886064,26886148-26886317,26887038-26887941, 26888544-26888575,26888862-26888928,26889116-26889173, 26889329-26889421,26890366-26890480,26890847-26890894, 26891012-26891057,26891161-26891231,26891865-26891870, 26891991-26892038,26892439-26892488,26892892-26893154 Length = 804 Score = 28.3 bits (60), Expect = 5.6 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 6/59 (10%) Frame = -1 Query: 438 PKERHRPTKLRDRNPSERHEQQRLSGLQERS--QRN-EPRARPPQS---GPERECVQER 280 P R R R R+P R + S +ERS +RN PR P +S P+R+ V+E+ Sbjct: 243 PARRERSPAPRSRSPRRRSPVKTTSSHRERSPVRRNGSPRRSPVRSIGRSPQRDRVKEQ 301 >02_02_0637 - 12491706-12492575,12492580-12492657 Length = 315 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +1 Query: 94 TTPASPTACQTPTPATSRA--STRP 162 TTP PT+C +PT +TS + +TRP Sbjct: 137 TTPWLPTSCSSPTSSTSPSARATRP 161 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Frame = -1 Query: 441 SPKERHRPTKLRDRNPS--ERHEQQ-----RLSGLQERSQRNEPRARPP 316 SP+ R RP+ RD PS E H + R+ RSQ + R R P Sbjct: 302 SPRHRMRPSHYRDNTPSRGEMHHHRDNTPSRVDSSPRRSQHEDFRDRSP 350 >02_05_0288 - 27549718-27549940,27550025-27550102,27550282-27550674, 27550752-27551347,27552232-27552978 Length = 678 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 103 ASPTACQTPTPATSRASTRPASVT 174 A+ AC T T AT+R++TRP T Sbjct: 60 ATAVACTTTTTATTRSATRPRKRT 83 >08_02_0377 + 16481232-16481361,16482501-16482547,16482634-16482711, 16482826-16482896,16483005-16483086 Length = 135 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Frame = +3 Query: 138 DVKSQHETRVGDSVVGQYSLLESDGTKRTV--DYAADAHSGFNAV--VRKDPALVHTPVL 305 D++ +SV+ L+S+ + DY +G++ + V+K P LVH PV+ Sbjct: 37 DIEENTRVTAVESVMQALVFLDSEHDVNMIVSDYCMPEMTGYDLLMEVKKSPRLVHLPVI 96 Query: 306 AHSA 317 S+ Sbjct: 97 IASS 100 >07_03_1389 + 26212117-26212119,26212721-26212875,26213402-26213479, 26214211-26214375,26214453-26214554,26214661-26214786, 26215454-26215490 Length = 221 Score = 27.5 bits (58), Expect = 9.8 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = -1 Query: 402 RNPSERHEQQRLSGLQERS--QR--NEPRARPPQSG--PERECVQERGPCAR 265 + PSE + R+SG + RS QR PR PP G P R R P R Sbjct: 122 KKPSEMRSRDRISGSRGRSYDQRYSRSPRYSPPPRGRSPYRSPSYSRSPSPR 173 >07_01_0543 + 4008439-4008808,4009209-4009274,4009409-4009584 Length = 203 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 106 SPTACQTPTPATSRASTRPASV 171 SPTA TP PATS+ TRP V Sbjct: 158 SPTATATP-PATSQTQTRPQVV 178 >06_01_0234 - 1784498-1784770 Length = 90 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 402 RNPSERHEQQRLSGLQERSQRNEPRARPP 316 R PSE+ ++ S +R +R PR PP Sbjct: 41 RQPSEQQQRGEGSSPSQREERRRPREAPP 69 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 67 PLTLARFMATTPASPTACQTPTPATSRASTRPASVTA**DSTLS 198 PL+ A F TPA+ + Q P P + +P+S A +S+ S Sbjct: 1302 PLSGATFFVPTPATVASEQIPDPTVNVHQDQPSSTIALRESSAS 1345 >03_06_0533 + 34565062-34565439 Length = 125 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +2 Query: 182 RTVLSLGI*RY*AHCRLRC*CSLWIQRRRAQGPRSCTHSRSGPLCGGRA 328 R + G+ R A RL C W+ RRR R R G L GG A Sbjct: 66 RRAAATGLRRLRARLRL---CFAWVSRRRNIHRRGARFGRYGRLSGGAA 111 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,800,219 Number of Sequences: 37544 Number of extensions: 219602 Number of successful extensions: 1099 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1090 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -