BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H04 (757 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0307 - 16546692-16546791,16548107-16548336 81 9e-16 09_04_0334 + 16779883-16780150,16780618-16781828 28 9.2 >07_03_0307 - 16546692-16546791,16548107-16548336 Length = 109 Score = 81.0 bits (191), Expect = 9e-16 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +2 Query: 221 EAGSGQINPCIRKDINKVVDFIDIEDITEKAS-LCRCWRSKNWPYCDGSHGPHNKETGDN 397 EAG G INP IRK+ KVVD + ++++ + CRCWRS +P CDGSH HNK TGDN Sbjct: 42 EAGVGGINPSIRKEEEKVVDTVLAGELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDN 101 Query: 398 TGPVVVR 418 GP++V+ Sbjct: 102 VGPLLVK 108 >09_04_0334 + 16779883-16780150,16780618-16781828 Length = 492 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 32 LKMSVVSHLVKVTIPNXLSSLPIPASVGGWFRLGVKXWLALIPPTV 169 LK+ + V+ + + +PI A G R+ +K W +PP + Sbjct: 77 LKVEAANTAVRAAVKRC-AEVPISARPGKMMRIAIKSWSRFLPPYI 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,044,471 Number of Sequences: 37544 Number of extensions: 337528 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -