BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_H03 (570 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70290.1 68414.m08087 trehalose-6-phosphate synthase, putativ... 29 2.9 At3g17620.1 68416.m02251 F-box family protein contains Pfam prof... 28 5.0 At1g23870.1 68414.m03011 glycosyl transferase family 20 protein ... 28 5.0 At4g22140.1 68417.m03200 PHD finger family protein / bromo-adjac... 27 6.7 At4g04260.1 68417.m00603 bromo-adjacent homology (BAH) domain-co... 27 6.7 At1g47600.1 68414.m05285 glycosyl hydrolase family 1 protein con... 27 6.7 At4g27570.1 68417.m03960 glycosyltransferase family protein cont... 27 8.8 >At1g70290.1 68414.m08087 trehalose-6-phosphate synthase, putative similar to Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (EC 2.4.1.15) (Trehalose-6-phosphate synthase) from {Kluyveromyces lactis} SP|Q07158, {Saccharomyces cerevisiae} SP|Q00764; contains Pfam profiles PF00982: Glycosyltransferase family 20, PF02358: Trehalose-phosphatase Length = 856 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 128 FENDWQPESKFPFSQVFLPPKDTGKHTEFTENQEVEVFARSNEK 259 FE W + K Q+ P + +GK E + + E R NE+ Sbjct: 358 FETYWHLKGKVVLVQIVNPARSSGKDVEEAKRETYETARRINER 401 >At3g17620.1 68416.m02251 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 398 Score = 27.9 bits (59), Expect = 5.0 Identities = 22/112 (19%), Positives = 46/112 (41%) Frame = +2 Query: 149 ESKFPFSQVFLPPKDTGKHTEFTENQEVEVFARSNEKEACGWWTANIKMMRGDFLVIEYL 328 E +F +++ ++ + + T + EVE +AR + +W A K +I + Sbjct: 172 EEEFVEYEIYELKSNSWRVLDVTSDWEVEFYARGVSLKGNTYWFATDKFPEISSNLIHSV 231 Query: 329 EWDNCYTEIVPKDRLRVKLPKTPIDKNTFHKFEITVPDELKDYAKVENAHKE 484 + C+ + R+ LP P+D +T + + + +N H E Sbjct: 232 YFLLCFNFTSERFGPRLHLPCYPMDVDTVSLSSVREEQLAVLFQRKDNLHME 283 >At1g23870.1 68414.m03011 glycosyl transferase family 20 protein / trehalose-phosphatase family protein contains Pfam profile: PF02358 trehalose-phosphatase Length = 867 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 128 FENDWQPESKFPFSQVFLPPKDTGKHTEFTENQEVEVFARSNEK 259 FE W K Q+ P + TGK E + + R NE+ Sbjct: 360 FETYWHMRGKLVLIQIVNPARATGKDVEEAKKETYSTAKRINER 403 >At4g22140.1 68417.m03200 PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein contains Pfam domain, PF00628: PHD-finger and PF01426: BAH domain Length = 196 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 185 PKDTGKHTEFTENQEVEVFARSNEKEACGWW 277 P D GK +++E AR+N K C W+ Sbjct: 3 PSDAGKPPYVARVEKIEADARNNVKVHCRWY 33 >At4g04260.1 68417.m00603 bromo-adjacent homology (BAH) domain-containing protein similar to ES43 [Hordeum vulgare] GI:1345528; contains Pfam profile PF01426: BAH domain Length = 193 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 185 PKDTGKHTEFTENQEVEVFARSNEKEACGWW 277 P D GK +++E AR+N K C W+ Sbjct: 3 PSDAGKAPYVARVEKIEADARNNVKVHCRWY 33 >At1g47600.1 68414.m05285 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to thioglucosidase (GI:871992) [Arabidopsis thaliana] Length = 511 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 155 LILAASHFQRLLEPRCRARR*QWPYNKHHFHRTPRPTNPPF 33 L + S Q++ P C+A+ N H F+RT P N F Sbjct: 16 LFVVVSSSQKVCNPECKAKEPFHCDNTHAFNRTGFPRNFTF 56 >At4g27570.1 68417.m03960 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 255 SLDLANTSTSWFSVNSVCLPVSLGGKKT*ENGN 157 S+++A T WFS S+C V+ K+ E GN Sbjct: 381 SVEVAREETGWFSKESLCDAVNSVMKRDSELGN 413 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,873,972 Number of Sequences: 28952 Number of extensions: 249910 Number of successful extensions: 652 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -