BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G23 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 31 0.042 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 29 0.17 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 28 0.22 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 27 0.39 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 26 0.90 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 26 1.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 1.6 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 1.6 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 25 2.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 6.4 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 8.4 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 30.7 bits (66), Expect = 0.042 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 110 VITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 V+ L ++N T SW + +++K + L N+L+ + NR Sbjct: 572 VVALDVRNAFNTASWQCIATALEDKGVPRQLRNILRDYFANR 613 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 28.7 bits (61), Expect = 0.17 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 59 FEDSNYSNNIFLTKWQCVITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 F +N +N FL V+++ +KN T SW + ++ K + L +++ + ENR Sbjct: 620 FRRTNGRDNRFLL----VVSMDVKNAFNTASWQAIATALQMKGVPAGLQRIVRSYFENR 674 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 28.3 bits (60), Expect = 0.22 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 338 WFMKCCLITNSKRL*QRIPWMYTL 409 WF++C LI R ++PWM+++ Sbjct: 270 WFVECSLIAVCARFFLQLPWMWSI 293 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 27.5 bits (58), Expect = 0.39 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +1 Query: 271 MNEDLTEAVKQNTRRYTNMVSDVVYEMLPDYKFKEVVAKDSLDVY 405 +N++L + +QN S + YE + + K+ E+ +S+ Y Sbjct: 324 LNQELQDKARQNITDVMKQHSSITYEAVHEMKYIEMCINESMRKY 368 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 26.2 bits (55), Expect = 0.90 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 292 AVKQNTRRYTNMVSDVVYEMLPDYKFKEVVAKD 390 AV++ T Y + VY + PD+ VVA+D Sbjct: 202 AVRERTNPYYDEAHKYVYRLSPDHIVTPVVAED 234 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.8 bits (54), Expect = 1.2 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +1 Query: 160 CQTDDEGKKYFKYAEQ--LTKVAHREQIAFEVDLDDLHEMNE-DLTEAVKQNTRRYTNMV 330 C+ D E YF + EQ + K F+VDL + EMNE ++ E + YT++ Sbjct: 148 CEIDVE---YFPFDEQTCVMKFGSWTYDGFQVDLRHIDEMNETNVVEVGVDLSEFYTSVE 204 Query: 331 SDVV 342 D++ Sbjct: 205 WDIL 208 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +2 Query: 110 VITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 V+ L ++N T SW + +++K + L N+L+ + +R Sbjct: 570 VVALDVRNAFNTASWQCIAEALRDKGVPLQLCNILQDYFTDR 611 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +2 Query: 110 VITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 V+ L ++N T SW + ++EK + + L +L+ + +R Sbjct: 585 VVALDVRNAFNTASWQSIANALREKGVPSGLLRILQSYFTDR 626 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +2 Query: 110 VITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 V+TL +KN + SW + ++ +I L +++ + NR Sbjct: 550 VVTLDVKNAFNSASWTAIARSLQRINIPKYLYDIIGNYFRNR 591 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = +2 Query: 77 SNNIFLTKWQCVITLQIKNLSRTFSWIFVKLMMKEKSILNMLNNLLKLHTENR 235 S N + ++ V+TL + N + SW+ + ++ + L +++ + NR Sbjct: 534 SRNRYSGRYCAVVTLDVTNAFNSASWLAIANALQRINTPKYLYDIIGDYFRNR 586 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 471 PRIPHFSRNPVVSGFQHN 418 PR PH S + +V GF+ N Sbjct: 32 PRSPHGSGHRIVGGFEIN 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,970 Number of Sequences: 2352 Number of extensions: 12435 Number of successful extensions: 29 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -