BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G20 (635 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 125 3e-29 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) 27 9.7 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 125 bits (301), Expect = 3e-29 Identities = 56/83 (67%), Positives = 71/83 (85%) Frame = +1 Query: 385 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLTGV 564 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I + +L +GFVFLFT+GGLTGV Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTGV 60 Query: 565 ILANSSIDITLHDTYYVVAHXHY 633 ILANSS+D+ +HDTYYVVAH HY Sbjct: 61 ILANSSLDVVMHDTYYVVAHFHY 83 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 364 HHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL 513 HH+ T+ I + T+I PT I + + +H T IN +P ++ Sbjct: 14 HHLHTIIIHLHPTVIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHPTVI 63 >SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) Length = 371 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 210 WTS*SLYFNFTRIWYNFSYYFTRKRKKRNFWLFRNNLCYTSNWVI 344 W++ LY + +W N Y + N L+ N+ C SN VI Sbjct: 326 WSNAVLYTYHSCLWSNAVLYTNHSCLRSNAVLYTNHSCLRSNAVI 370 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,697,223 Number of Sequences: 59808 Number of extensions: 214802 Number of successful extensions: 387 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -