BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G19 (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces po... 27 1.8 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 27 2.3 SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|c... 27 3.1 SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch... 26 5.3 SPBC36.12c |git7||SGT1-like protein Git7|Schizosaccharomyces pom... 26 5.3 SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 25 9.3 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 9.3 >SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 17 IALDVISAGCIQSRSFFFSSARVIVMSISAR 109 + L+ IS+ C+Q +SFF +AR + S+ +R Sbjct: 153 VPLEWISSICMQVQSFFSPAAREAISSLKSR 183 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 327 IEHHVRQGFVPFDQRC 280 I HHVR+ + PF+ RC Sbjct: 299 IYHHVRRAYNPFEDRC 314 >SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 26.6 bits (56), Expect = 3.1 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = +1 Query: 85 YCDVDFSERPRNFSIELLYHTQTQTDGHVVISPFGIWTLMTGIALGASGNSYRQLSRAFI 264 Y + F+E N + TQT D +PFG++ L+ G+ S R + AF Sbjct: 248 YHGMVFTETFGNLAYAFACRTQTLRDVGGNANPFGVFLLLQGLET-LSLRMERHVQNAFA 306 Query: 265 LPK 273 L K Sbjct: 307 LAK 309 >SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 979 Score = 25.8 bits (54), Expect = 5.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 544 GSRQSAERSRRVPRIFRCRCWLFE 473 GS E + +FRCRC +F+ Sbjct: 71 GSNDDEEDDLDITTLFRCRCMIFD 94 >SPBC36.12c |git7||SGT1-like protein Git7|Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.8 bits (54), Expect = 5.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 548 SWKSSERRTFETRPP 504 +WK + +TFET+PP Sbjct: 357 NWKDVKSKTFETKPP 371 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 25.0 bits (52), Expect = 9.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 14 SIALDVISAGCIQSRSFFFSSARVIVMSIS 103 SI VIS GC Q+ F FS A + + IS Sbjct: 136 SIYQGVISHGCFQTAPFHFSHAGLGDLKIS 165 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 270 GQNKRSAQLPVAITGRS*SDSRHQSPYPKRRDHNVPISLS 151 G NK + P ++ + S S H+S P+RR+ + +S+S Sbjct: 121 GMNKSVHEYPFTLSESAISSS-HKSSIPERRNFDSSVSVS 159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,634,863 Number of Sequences: 5004 Number of extensions: 54641 Number of successful extensions: 143 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -