SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_G11
         (602 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    28   0.053
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   3.5  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   3.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   3.5  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   3.5  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   3.5  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   3.5  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   3.5  

>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 28.3 bits (60), Expect = 0.053
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = -3

Query: 288 RTKILYFLILLVKLDVTYNYCVRWRPSDG-VYGNITSKXSF 169
           +  IL+  I+ +KLD +  Y +  +P DG +  NIT+K  F
Sbjct: 160 KVTILHPNIVKLKLDTSEGYTLSVKPRDGEIVANITAKTFF 200


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 609 GFNEFYNQRRRW 620


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 869 GFNEFYNQRRRW 880



 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +1

Query: 112 PHFLFEAPPMVLL 150
           P+  FE+PP+V L
Sbjct: 443 PYLFFESPPVVFL 455


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 869 GFNEFYNQRRRW 880



 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +1

Query: 112 PHFLFEAPPMVLL 150
           P+  FE+PP+V L
Sbjct: 443 PYLFFESPPVVFL 455


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 842 GFNEFYNQRRRW 853


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 842 GFNEFYNQRRRW 853


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 869 GFNEFYNQRRRW 880



 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +1

Query: 112 PHFLFEAPPMVLL 150
           P+  FE+PP+V L
Sbjct: 443 PYLFFESPPVVFL 455


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 107 GVRTFYSKRRRW 142
           G   FY++RRRW
Sbjct: 869 GFNEFYNQRRRW 880



 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +1

Query: 112 PHFLFEAPPMVLL 150
           P+  FE+PP+V L
Sbjct: 443 PYLFFESPPVVFL 455


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,923
Number of Sequences: 336
Number of extensions: 2387
Number of successful extensions: 14
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15248386
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -