BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G09 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 4.9 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 28.7 bits (61), Expect = 4.9 Identities = 30/118 (25%), Positives = 47/118 (39%), Gaps = 5/118 (4%) Frame = +3 Query: 18 CLVQVAKXKKXXPSFSQNKFGI---FFSRHQVSLFFXKMAQTAGVKPMXXVGRVASEREX 188 CL K SQ ++ + +FSR+ V L + T+GV R R+ Sbjct: 435 CLFVTLTYPKAQNRASQYRYVLRDHYFSRYCVRLAVGYLRNTSGVIEQTASSRSRGARDA 494 Query: 189 CLGMTDAERAWRKQWLKXQV-LAAHEPVHVEEYWR-ERTNPIRRFYRKPLDVLFAKLT 356 L + ++A+ K W K L E + V++ + I R+Y D L LT Sbjct: 495 SLSASHLKKAFEK-WFKDMAGLIEMENLKVKDLKALAKERGIPRYYWMRRDELVGALT 551 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,521,445 Number of Sequences: 59808 Number of extensions: 420954 Number of successful extensions: 916 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -