BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G08 (549 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 3.6 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 4.7 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 84 SXTASQGLGVXRSXKPLSYH 143 S A++GLGV +PLS H Sbjct: 100 SKFANRGLGVFERTEPLSPH 119 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +2 Query: 20 FICQAKWRXIRNAHSKNNLQSFLXRKSRSWCXAEHXTVELPQGC 151 +IC+ +WR I N NL K +W + +GC Sbjct: 378 WICEHRWRQIYNMVRFRNLVK--GTKIDNWWDNGSNQIAFSRGC 419 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,823 Number of Sequences: 438 Number of extensions: 2476 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -