BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_G01 (659 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26850.1 68418.m03203 expressed protein 29 2.7 At1g80920.1 68414.m09494 DNAJ heat shock N-terminal domain-conta... 29 2.7 At4g05580.1 68417.m00849 hypothetical protein 29 3.6 At3g01680.1 68416.m00099 expressed protein 29 3.6 At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ri... 28 4.8 At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) 28 4.8 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 28 4.8 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 28 4.8 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 28 4.8 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 28 4.8 At1g42630.1 68414.m04918 zinc knuckle (CCHC-type) family protein... 28 6.3 At1g40080.1 68414.m04737 hypothetical protein member of hypothet... 28 6.3 >At5g26850.1 68418.m03203 expressed protein Length = 919 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 214 HYKIEDREGLRNIDSDFWKEAYNTYQKDLVSPAAEGTLNEQLNW 345 H +E R G I S ++ Q L S A G LNE NW Sbjct: 498 HPNVETRVGAHEIFSVILLQSSGQSQAGLASVRASGYLNESRNW 541 >At1g80920.1 68414.m09494 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q05646 Chaperone protein dnaJ Erysipelothrix rhusiopathiae, SP|P45555 Chaperone protein dnaJ (HSP40) Staphylococcus aureus; contains Pfam profile PF00226 DnaJ domain Length = 163 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 608 VCRGSGCGEVFSTLAKAASLIL 543 VCRGS CG F T+ +A ++L Sbjct: 86 VCRGSNCGVQFQTINEAYDIVL 107 >At4g05580.1 68417.m00849 hypothetical protein Length = 116 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 305 VQRQKGR*MNNSIGYCRMRCGWNTRIMLTN 394 V++ KG ++ GY +MRC WN ++ TN Sbjct: 84 VEKNKGLAYESTTGYYQMRCRWN--VLTTN 111 >At3g01680.1 68416.m00099 expressed protein Length = 740 Score = 28.7 bits (61), Expect = 3.6 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 2/117 (1%) Frame = +1 Query: 4 LCYRHVELHLDNFVKFTPTCYLKT-YSFLTMSNLFKLK-LSALGHPNPEFFNCEDEKEYR 177 LCYRH+E K + LK +S +++ +K L+AL HP P +D R Sbjct: 295 LCYRHIE-------KQRSSESLKVLHSLFDTTHIDNMKILTALVHPKPHITPLQDGLTKR 347 Query: 178 SVVLWLEDQKIRHYKIEDREGLRNIDSDFWKEAYNTYQKDLVSPAAEGTLNEQLNWL 348 V L + +K I D L++ + +++ Y +++LV + + ++ W+ Sbjct: 348 KVHLDVLRRKTVLLLISDLNILQD-ELSIFEQIYTESRRNLVGVDGKSHMPYEVVWV 403 >At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ribosomal protein S2 - Arabidopsis thaliana, SWISSPROT:RS2_ARATH Length = 276 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 218 LGNFVKATFDCLQKTYGFLT 237 >At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) Length = 285 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 227 LGNFVKATFDCLQKTYGFLT 246 >At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar to ribosomal protein S2 GI:430711 from [Drosophila melanogaster] Length = 284 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 226 LGNFVKATFDCLQKTYGFLT 245 >At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar to ribosomal protein S2 GI:939717 from [Urechis caupo] Length = 284 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 226 LGNFVKATFDCLQKTYGFLT 245 >At1g58684.1 68414.m06657 40S ribosomal protein S2, putative Length = 284 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 226 LGNFVKATFDCLQKTYGFLT 245 >At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar to ribosomal protein S2 GI:939717 from (Urechis caupo) Length = 284 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 31 LDNFVKFTPTCYLKTYSFLT 90 L NFVK T C KTY FLT Sbjct: 226 LGNFVKATFDCLQKTYGFLT 245 >At1g42630.1 68414.m04918 zinc knuckle (CCHC-type) family protein contains Pfam profile PF00098: Zinc knuckle Length = 154 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 305 VQRQKGR*MNNSIGYCRMRCGWN 373 V++ KG ++ GY +MRC WN Sbjct: 84 VEKNKGLTYESTTGYYQMRCRWN 106 >At1g40080.1 68414.m04737 hypothetical protein member of hypothetical protein common family Length = 154 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 305 VQRQKGR*MNNSIGYCRMRCGWN 373 V++ KG ++ GY +MRC WN Sbjct: 84 VEKNKGLAYESTTGYYQMRCRWN 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,254,603 Number of Sequences: 28952 Number of extensions: 227509 Number of successful extensions: 618 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -