BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F18 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 152 1e-38 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 78 3e-16 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.9 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 24 5.0 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 24 5.0 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 24 5.0 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 24 5.0 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 24 5.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.0 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.6 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 23 6.6 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 152 bits (368), Expect = 1e-38 Identities = 69/161 (42%), Positives = 107/161 (66%) Frame = +2 Query: 182 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 361 FK +++G++ VGKS L+L+F +F + TIG F + + ID +K +IWDTAGQE Sbjct: 25 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQE 84 Query: 362 AFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESR 541 + S+ YYRGA A++VYDI ++F TW+++ ++ ++ N+VI L GNK+DL + Sbjct: 85 RYHSLAPMYYRGAQAAIVVYDIQNSDSFARAKTWVKELQRQASPNIVIALAGNKADLANS 144 Query: 542 REVKKEEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEI 664 R V EE + +A ++ L+FMETSAKTA NV + F+ AK++ Sbjct: 145 RVVDYEEAKQYADDNRLLFMETSAKTAVNVNDIFLAIAKKL 185 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 77.8 bits (183), Expect = 3e-16 Identities = 49/167 (29%), Positives = 85/167 (50%), Gaps = 14/167 (8%) Frame = +2 Query: 185 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEA 364 K +++GD VGK+C+L+ +T F + T + A M+ +DG Q+ L +WDTAGQE Sbjct: 8 KCVVVGDGTVGKTCMLISYTTDSFPGEYVPTSFDNYSAPMV-VDGVQVSLGLWDTAGQED 66 Query: 365 FRSITRSYYRGAAGALLVYDITRRETFNHLTT-WLEDARQHSNSNMVIMLIGNKSDLESR 541 + + Y L+ Y + +F ++T+ W + + H + I+L+G K DL Sbjct: 67 YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHC-PDAPIILVGTKIDLRED 125 Query: 542 RE------------VKKEEGEAFARE-HGLVFMETSAKTAANVEEAF 643 RE +K+E+G+ A + + +ME SA T +++ F Sbjct: 126 RETISLLADQGLSALKREQGQKLANKIRAVKYMECSALTQRGLKQVF 172 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 448 IESLPSGDVVN*QSASRAPVVRSGDGPKSFLTS 350 + SLP G+V + S + A + R+ DG F+ S Sbjct: 1169 LTSLPVGEVFDTNSNTLAVISRTNDGKNVFVRS 1201 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 448 IESLPSGDVVN*QSASRAPVVRSGDGPKSFLTS 350 + SLP G+V + S + A + R+ DG F+ S Sbjct: 1170 LTSLPVGEVFDTNSNTLAVISRTNDGKNVFVRS 1202 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 136 RGFILNCAPGTLFNPNTRECDHPS 159 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 136 RGFILNCAPGTLFNPNTRECDHPS 159 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 135 RGFILNCAPGTLFNPNTRECDHPS 158 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 135 RGFILNCAPGTLFNPNTRECDHPS 158 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 135 RGFILNCAPGTLFNPNTRECDHPS 158 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 207 RGFILNCAPGTLFNPNTRECDHPS 230 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 367 KSFLTSCVPNLQLDLLAINCDHPS 296 + F+ +C P + CDHPS Sbjct: 206 RGFILNCAPGTLFNPNTRECDHPS 229 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 616 LGRRLHEDEAVLASERFAFFLLHFTSGF 533 L +L DE +L + R F+L FTS F Sbjct: 784 LNFKLQLDEVLLKANRTLGFILRFTSIF 811 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 607 RLHEDEAVLASERFAFFLLHFTSGFEIALVTDKHNDHI 494 RLH A + L HF FE + DK +H+ Sbjct: 143 RLHGPGATTVVLDEVYKLKHFEQMFENGVFVDKFEEHV 180 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,991 Number of Sequences: 2352 Number of extensions: 13017 Number of successful extensions: 80 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -