BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F15 (531 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 75 1e-12 UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; ... 33 5.4 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 74.9 bits (176), Expect = 1e-12 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +3 Query: 159 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQLTAAAMVAPTP 332 IYGTGGLLTP+VAP+L YYGN+VAGS++SQLT+AAM+APTP Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQLTSAAMLAPTP 74 >UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Putative uncharacterized protein - Aurantimonas sp. SI85-9A1 Length = 215 Score = 32.7 bits (71), Expect = 5.4 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +2 Query: 113 GASXCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNS-GRKHSRCCTSILRKFSGR-Q 286 G G GR+ + +G R+ + SGN G+ R C + GR Q Sbjct: 45 GEQSLAPGNSGRQITGKQKRSNNGQEAGQRSEPRHSGNERGKAEQRWCVDESNRRGGRSQ 104 Query: 287 HCVTVDCCCHGSPH 328 CV CHGSP+ Sbjct: 105 LCVAAAMRCHGSPN 118 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 387,441,865 Number of Sequences: 1657284 Number of extensions: 6784705 Number of successful extensions: 14415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14410 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 33873797511 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -