BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F12 (529 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 3.8 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 5.1 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 144 LYFDTNKXICEXIAIIPTKPLRNK 215 LYFD +K C+ + L+NK Sbjct: 79 LYFDIDKQTCDWKDSVKNCKLKNK 102 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 5.1 Identities = 9/40 (22%), Positives = 22/40 (55%) Frame = +3 Query: 276 SIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKDMLKML 395 ++K +E++ ++ + + D+I+V+P+ D K L Sbjct: 265 AVKRKEKKAQKEKDKPNSTTNGSPDVIKVEPELSDSEKTL 304 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,359 Number of Sequences: 336 Number of extensions: 1841 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -