BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F12 (529 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 164 1e-42 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 24 2.7 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.7 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.8 AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 23 4.8 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 164 bits (399), Expect = 1e-42 Identities = 80/95 (84%), Positives = 86/95 (90%) Frame = +3 Query: 150 FDTNKXICEXIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRDNYVPE 329 FDTNK I E +AIIPTKPLRNKIAGF THLM+RLRHSQVRGISIKLQEEERERRDNYVP+ Sbjct: 28 FDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEEERERRDNYVPD 87 Query: 330 VSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQP 434 VSALE DIIEVDP+TK+MLK LDFNNI +QLT P Sbjct: 88 VSALEQDIIEVDPETKEMLKHLDFNNI-VVQLTNP 121 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 24.2 bits (50), Expect = 2.7 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 270 GISIKLQEEERERRDNYVPEVSALE-HDIIEVDPDTKDMLKMLDFNN 407 G + +L+EEE + + + PE+ E + ++V + K+M+ + D +N Sbjct: 87 GTTCELEEEEVDLQAKHAPEMDGSELMEAVDVAAELKNMV-LQDISN 132 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 247 VSDTRKCEESLSNFRKRSVRGVTTMSQKCLLSNMTS 354 +++TR C E++S F+ R T+ +K + + TS Sbjct: 356 INETRVCGENISTFQLEERRRRRTVIEKLNIEDGTS 391 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 4.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 348 DIIEVDPDTKDMLKMLDFNNINGL 419 DI +VDPD L + NNI G+ Sbjct: 636 DIEDVDPDLHRSLTWILENNITGI 659 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 91 VKSSGXAYY*KXLYKLNTCILIQIKXYVKXSLSFLP 198 +K+ Y + L K + C+L+ + YVK +P Sbjct: 123 IKTRARKLYDQVLTKFDGCLLMDDETYVKADFGQIP 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 447,323 Number of Sequences: 2352 Number of extensions: 7387 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -