BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F10 (406 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopt... 95 5e-19 UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=... 92 3e-18 UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukar... 89 3e-17 UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabi... 89 4e-17 UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal ... 87 2e-16 UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukary... 81 1e-14 UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; ... 78 8e-14 UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal ... 77 2e-13 UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: ... 67 1e-10 UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; ... 66 3e-10 UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; ... 65 6e-10 UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal ... 64 1e-09 UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces cap... 62 3e-09 UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, put... 60 1e-08 UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyosteli... 58 7e-08 UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; ... 57 2e-07 UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella ve... 56 2e-07 UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; ... 55 5e-07 UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S riboso... 54 1e-06 UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; T... 53 2e-06 UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, wh... 53 2e-06 UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S riboso... 49 3e-05 UniRef50_A2DHA1 Cluster: Putative uncharacterized protein; n=2; ... 46 4e-04 UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; ... 44 9e-04 UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n... 42 0.006 UniRef50_Q0TXH9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 0.41 UniRef50_UPI0000498337 Cluster: lysozyme; n=1; Entamoeba histoly... 33 2.2 UniRef50_Q9ZWC3 Cluster: F21M11.3 protein; n=14; core eudicotyle... 32 3.8 UniRef50_UPI0000E81F9E Cluster: PREDICTED: hypothetical protein,... 31 6.6 UniRef50_A6SXL6 Cluster: Uncharacterized conserved protein; n=35... 31 6.6 UniRef50_A7TIL9 Cluster: Putative uncharacterized protein; n=1; ... 31 6.6 UniRef50_A7F394 Cluster: Predicted protein; n=4; Fungi/Metazoa g... 31 6.6 UniRef50_UPI0000F2C584 Cluster: PREDICTED: hypothetical protein;... 31 8.7 UniRef50_UPI0000519DFF Cluster: PREDICTED: similar to Caspase pr... 31 8.7 UniRef50_Q76NU0 Cluster: Putative uncharacterized protein; n=2; ... 31 8.7 UniRef50_A2FZI3 Cluster: Putative uncharacterized protein; n=1; ... 31 8.7 UniRef50_Q7S9S3 Cluster: Putative uncharacterized protein NCU065... 31 8.7 >UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopterygota|Rep: 60S ribosomal protein L29 - Drosophila melanogaster (Fruit fly) Length = 76 Score = 95.1 bits (226), Expect = 5e-19 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 201 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=2; Neoptera|Rep: Ribosomal protein L29e-like protein - Maconellicoccus hirsutus (hibiscus mealybug) Length = 90 Score = 92.3 bits (219), Expect = 3e-18 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 MAKSKNHTNHNQNRK HRNGIKKP++ R+ES LG+ KFL+NQRF KGNL A+Q+ Sbjct: 1 MAKSKNHTNHNQNRKDHRNGIKKPKRYRYESKLGVCQKFLKNQRFALKGNLSTAEQV 57 >UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukaryota|Rep: 60S ribosomal protein L29 - Homo sapiens (Human) Length = 159 Score = 89.0 bits (211), Expect = 3e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabidopsis thaliana|Rep: 60S ribosomal protein L29-2 - Arabidopsis thaliana (Mouse-ear cress) Length = 61 Score = 88.6 bits (210), Expect = 4e-17 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 204 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52 >UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal protein L29,; n=3; Monodelphis domestica|Rep: PREDICTED: similar to ribosomal protein L29, - Monodelphis domestica Length = 407 Score = 86.6 bits (205), Expect = 2e-16 Identities = 39/57 (68%), Positives = 44/57 (77%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHKKKGLKKM 57 >UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukaryota|Rep: 60S ribosomal protein L29 - Schizosaccharomyces pombe (Fission yeast) Length = 61 Score = 80.6 bits (190), Expect = 1e-14 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQ 216 MAKSKNHTNHNQN+KAHRNGIK+P+K R++S D KF RNQ+F +G ++ +Q Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTVEAIRQ 56 >UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; Eukaryota|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 282 Score = 77.8 bits (183), Expect = 8e-14 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 46 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAK 213 +MAKSKN + HNQ RKAHRNGIKKP+ ++ S G+DPKF+RNQR+ K G K K Sbjct: 93 RMAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLRGVDPKFVRNQRYAKHGTEKALK 148 >UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal protein L29/cell surface heparin binding protein HIP; n=4; Monodelphis domestica|Rep: PREDICTED: similar to ribosomal protein L29/cell surface heparin binding protein HIP - Monodelphis domestica Length = 252 Score = 76.6 bits (180), Expect = 2e-13 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 MAKSKNHT HNQ+RK HRNGIKKPR ++ES DPKFLRN F KK K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSLKYESLKEADPKFLRNTPFGKKYKKKGLKKM 57 >UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: GLP_433_2266_2454 - Giardia lamblia ATCC 50803 Length = 62 Score = 66.9 bits (156), Expect = 1e-10 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQR 180 MAK KNHT+ NQNRK HRNGIKKP+K+ + S GM PK+LRN R Sbjct: 1 MAKLKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRNLR 44 >UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 97 Score = 66.1 bits (154), Expect = 3e-10 Identities = 39/78 (50%), Positives = 45/78 (57%), Gaps = 21/78 (26%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLG---------------------MDPKF 165 MAKSKNHTNHNQN+KAH+NGI KP++ R+EST G M KF Sbjct: 1 MAKSKNHTNHNQNQKAHKNGITKPKRQRNESTRGVSIISVACPLNRYPNVWPYLQMCQKF 60 Query: 166 LRNQRFCKKGNLKPAKQL 219 L N RF KKGNL + L Sbjct: 61 LHNLRFSKKGNLSREESL 78 >UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 59 Score = 64.9 bits (151), Expect = 6e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +1 Query: 85 NRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 NRKAHRNGIKKP+ + S G+DPKF RNQ++C KG +K K+L Sbjct: 1 NRKAHRNGIKKPKSHKFMSRKGLDPKFFRNQKYCLKGMIKKQKEL 45 >UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal protein; n=2; Mus musculus|Rep: PREDICTED: similar to ribosomal protein - Mus musculus Length = 244 Score = 64.1 bits (149), Expect = 1e-09 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +1 Query: 52 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 192 AKSKNH HNQ+ K +RNGIKKPR ++ + G+ PKFLRN F KK Sbjct: 47 AKSKNHITHNQSCKWYRNGIKKPRSPKNSTLPGLAPKFLRNMHFAKK 93 >UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 176 Score = 62.5 bits (145), Expect = 3e-09 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = +1 Query: 67 HTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 H+ H NRKAHRNGIKKP+ R+ S G DPKF RN R G +K K++ Sbjct: 118 HSQHTLNRKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEV 168 >UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, putative; n=1; Filobasidiella neoformans|Rep: Ribosomal protein L29.e, cytosolic, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 99 Score = 60.5 bits (140), Expect = 1e-08 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK--FLRNQR 180 MAKSKNHT HNQ RKAHRN I++P+ ++ S G+DPK F RN + Sbjct: 1 MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKVGFFRNAK 46 >UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyostelium discoideum AX4|Rep: Ribosomal protein L29 - Dictyostelium discoideum AX4 Length = 93 Score = 58.0 bits (134), Expect = 7e-08 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKG 195 MAKSKNH+ H++NRK HRNGIKK + S+ G++ F RNQR+ + G Sbjct: 1 MAKSKNHSTHHKNRKDHRNGIKKAVVHKKTSSKGVELGFARNQRYARIG 49 >UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 87 Score = 56.8 bits (131), Expect = 2e-07 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +1 Query: 55 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 198 K +NHTNHN+N KAHRNGI KP+K S G +F+++ RF +K N Sbjct: 14 KPENHTNHNRNNKAHRNGITKPKKHIFLSIEGSRRQFIKSLRFFRKNN 61 >UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 94 Score = 56.4 bits (130), Expect = 2e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +1 Query: 91 KAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 204 K HRNGIKKPR R+ S G+DPKFLRN RF KK N K Sbjct: 50 KWHRNGIKKPRTNRYPSLKGVDPKFLRNLRFSKKHNKK 87 >UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal protein L29 - Entamoeba histolytica HM-1:IMSS Length = 64 Score = 55.2 bits (127), Expect = 5e-07 Identities = 23/48 (47%), Positives = 35/48 (72%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 192 M+K KN ++HNQ+ KAHRNG KP+K+ + ST GM+ + L+N + +K Sbjct: 1 MSKDKNRSSHNQSHKAHRNGFYKPKKSAYMSTKGMNVQVLKNTKAQRK 48 >UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S ribosomal protein L29 (P23); n=2; Rattus norvegicus|Rep: PREDICTED: similar to 60S ribosomal protein L29 (P23) - Rattus norvegicus Length = 105 Score = 53.6 bits (123), Expect = 1e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +1 Query: 58 SKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRN 174 SKNHT HNQ K HRNGIKKP R++S +DP LRN Sbjct: 5 SKNHTTHNQFHKWHRNGIKKPWSQRYKSLKVVDPNILRN 43 >UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; Trypanosomatidae|Rep: Ribosomal protein L29, putative - Leishmania major Length = 70 Score = 52.8 bits (121), Expect = 2e-06 Identities = 30/55 (54%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTR-HESTLGMDPKFLRNQRFCKKGNLKPA 210 MAKSKNHTNHNQ+ K HRNGIK P H S G L N R +K N K A Sbjct: 1 MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHNQKAA 55 >UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_17, whole genome shotgun sequence - Paramecium tetraurelia Length = 73 Score = 52.8 bits (121), Expect = 2e-06 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 198 MAKSKN T+H+ RK HRNGIKK R+ + G + +F +N+RF K + Sbjct: 1 MAKSKNATSHHNARKHHRNGIKKLPNQRYRTLKGCNQRFAKNRRFAIKND 50 >UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP); n=1; Macaca mulatta|Rep: PREDICTED: similar to 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP) - Macaca mulatta Length = 237 Score = 49.2 bits (112), Expect = 3e-05 Identities = 25/59 (42%), Positives = 37/59 (62%) Frame = +1 Query: 43 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 ++ S + T HNQ+RK +RNGIKK + +R+ ++PK LRN F KK N K K++ Sbjct: 26 VQTCPSPHTTTHNQSRKWNRNGIKKSQSSRYNFLKLVNPK-LRNMHFAKKYNKKGMKKI 83 >UniRef50_A2DHA1 Cluster: Putative uncharacterized protein; n=2; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 58 Score = 45.6 bits (103), Expect = 4e-04 Identities = 23/56 (41%), Positives = 32/56 (57%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQ 216 MAK N + HN++ + HRNGI K + GM+ KFLRN R+ K G K ++ Sbjct: 1 MAKRSNTSAHNRSHQHHRNGIHKCVVKKLWFEKGMNAKFLRNARYAKAGQNKSEEE 56 >UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 167 Score = 44.4 bits (100), Expect = 9e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 55 KSKNHTNHNQNRKAHRNGIKKPR 123 KSKNHTNHNQN AHR GI KP+ Sbjct: 80 KSKNHTNHNQNNTAHRIGITKPK 102 >UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n=1; Rattus norvegicus|Rep: UPI0000DC0BB6 UniRef100 entry - Rattus norvegicus Length = 142 Score = 41.5 bits (93), Expect = 0.006 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 144 MAKSKNHT H Q++K HRN IKKP+ + +T Sbjct: 17 MAKSKNHTTH-QSQKWHRNSIKKPKSFKGATT 47 >UniRef50_Q0TXH9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 120 Score = 35.5 bits (78), Expect = 0.41 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 112 KKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 +KP+ R+ S G DPKF RN R G +K K++ Sbjct: 77 RKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEV 112 >UniRef50_UPI0000498337 Cluster: lysozyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: lysozyme - Entamoeba histolytica HM-1:IMSS Length = 747 Score = 33.1 bits (72), Expect = 2.2 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 103 NGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 219 N KPRKT+ E L + L+ Q + K G LK K+L Sbjct: 363 NNTSKPRKTKEEKRLSKRIRKLKRQLYDKNGKLKEIKRL 401 >UniRef50_Q9ZWC3 Cluster: F21M11.3 protein; n=14; core eudicotyledons|Rep: F21M11.3 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 418 Score = 32.3 bits (70), Expect = 3.8 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 46 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 162 K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 215 KSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >UniRef50_UPI0000E81F9E Cluster: PREDICTED: hypothetical protein, partial; n=3; Gallus gallus|Rep: PREDICTED: hypothetical protein, partial - Gallus gallus Length = 695 Score = 31.5 bits (68), Expect = 6.6 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 43 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLG 150 +K+ + +H +R R G +PRK +H STLG Sbjct: 222 VKLQRRHDHERDESSRSPARRGPGRPRKRKHCSTLG 257 >UniRef50_A6SXL6 Cluster: Uncharacterized conserved protein; n=35; Betaproteobacteria|Rep: Uncharacterized conserved protein - Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis) Length = 305 Score = 31.5 bits (68), Expect = 6.6 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -2 Query: 210 GWLQVTLLAKPLIP*KFWIHAKGGFVPGLPWLFD 109 GWL VTL P F +H+ G FV PW + Sbjct: 233 GWLNVTLSVTTPSPDGFGLHSSGMFVHNPPWTLE 266 >UniRef50_A7TIL9 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 1055 Score = 31.5 bits (68), Expect = 6.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 55 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQ 177 K+ NH N N N K +KP T S + P+ L+ + Sbjct: 323 KNNNHNNTNSNSKNQNQSSQKPHSTHSVSHMHSKPRILKEE 363 >UniRef50_A7F394 Cluster: Predicted protein; n=4; Fungi/Metazoa group|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 116 Score = 31.5 bits (68), Expect = 6.6 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQ 216 KR K KS NHN N + N KK +K + + K + ++ KK K K+ Sbjct: 32 KRNKNLKSHKRNNHNNNNNNNNNNKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 91 >UniRef50_UPI0000F2C584 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 87 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTL 147 K+ K K+KN N+N+K + KK +KT ES + Sbjct: 40 KKQKQKKNKNKNKKNKNKKNKKKNKKKKKKTAMESQI 76 >UniRef50_UPI0000519DFF Cluster: PREDICTED: similar to Caspase precursor (drICE); n=1; Apis mellifera|Rep: PREDICTED: similar to Caspase precursor (drICE) - Apis mellifera Length = 280 Score = 31.1 bits (67), Expect = 8.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 64 NHTNHNQNRKAHRNGIKKPRKTRHE--STLGMDPKFLRNQRFCK 189 NH NR++ RNG K +E STLG + K ++ +F K Sbjct: 50 NHEKFENNRESQRNGTNYDEKAINETFSTLGFEVKIYKDLKFNK 93 >UniRef50_Q76NU0 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum (Slime mold) Length = 760 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 58 SKNHTNHNQNRKAHRNGIKKP-RKTRHESTLGMDPKFLRN 174 + N+ N+N+N+K++ NGI +R ++ L MD L N Sbjct: 45 NNNNNNNNKNKKSYHNGIADSYSNSREDTNLDMDKNNLAN 84 >UniRef50_A2FZI3 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 795 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 55 KSKNHTNHNQNRKAHRNGIKKPRKTRH--ESTLGMDPKFLRNQ 177 K+KNH NHN H + +K ++H + DPK +N+ Sbjct: 506 KNKNHENHNSKNSTHTSSNEKKNSSKHNEDDKNHEDPKSDKNK 548 >UniRef50_Q7S9S3 Cluster: Putative uncharacterized protein NCU06592.1; n=2; Sordariales|Rep: Putative uncharacterized protein NCU06592.1 - Neurospora crassa Length = 512 Score = 31.1 bits (67), Expect = 8.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 52 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 162 A + N+T NQN + +NG P K R ++L +D + Sbjct: 102 ATNANNTTSNQNNNSSQNGSLSPPKERERNSLTLDQR 138 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 285,712,822 Number of Sequences: 1657284 Number of extensions: 5137710 Number of successful extensions: 16846 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 16151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16801 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 17773009086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -