BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F10 (406 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces... 81 8e-17 SPBC342.06c |rtt109|kat11|RTT109 family histone lysine acetyltra... 25 4.5 SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe... 25 5.9 SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces po... 25 5.9 SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF... 24 7.8 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 24 7.8 >SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 80.6 bits (190), Expect = 8e-17 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQ 216 MAKSKNHTNHNQN+KAHRNGIK+P+K R++S D KF RNQ+F +G ++ +Q Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTVEAIRQ 56 >SPBC342.06c |rtt109|kat11|RTT109 family histone lysine acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 369 Score = 25.0 bits (52), Expect = 4.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRK 126 +AK + NHN ++ A + I +PRK Sbjct: 340 LAKRDDRKNHNHSKPATQANILQPRK 365 >SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 24.6 bits (51), Expect = 5.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 80 TKTAKLTEMVSKSQGRPGTN 139 T A +T++VSK G PG N Sbjct: 220 TNPADITDLVSKYAGPPGNN 239 >SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1057 Score = 24.6 bits (51), Expect = 5.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 35 ENASKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQN 163 E+ S+ ++I TK KLT K++ R LAW+Q+ Sbjct: 999 EDLSEKDLKKIEAKATKKKKLTRNEIKAKERRARERELAWLQS 1041 >SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF3c|Schizosaccharomyces pombe|chr 1|||Manual Length = 918 Score = 24.2 bits (50), Expect = 7.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 67 HTNHNQNRKAHRNGIKKPRKTRHES 141 HTN +NR+ + G K R R E+ Sbjct: 887 HTNPQENRRRDKGGSVKRRNERTEN 911 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 24.2 bits (50), Expect = 7.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 184 KTFDSLKILDPCQGWIRAWSSLAF*YHFC 98 K SL +LD + AW+SL Y+ C Sbjct: 518 KDLQSLNVLDISLKGVNAWNSLETSYYNC 546 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,183,939 Number of Sequences: 5004 Number of extensions: 21545 Number of successful extensions: 65 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -