BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F10 (406 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 89 1e-18 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 89 1e-18 At1g04030.1 68414.m00390 expressed protein 32 0.13 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 32 0.17 At4g37950.1 68417.m05365 expressed protein 28 2.7 At3g48200.1 68416.m05259 expressed protein 28 2.7 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 27 3.6 At5g56560.1 68418.m07058 F-box family protein contains F-box dom... 27 6.3 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 8.3 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 26 8.3 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 89.0 bits (211), Expect = 1e-18 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +1 Query: 46 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 204 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 74 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 88.6 bits (210), Expect = 1e-18 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 204 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52 >At1g04030.1 68414.m00390 expressed protein Length = 418 Score = 32.3 bits (70), Expect = 0.13 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 46 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 162 K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 215 KSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 31.9 bits (69), Expect = 0.17 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 61 KNHTNHNQNRKAHRNGIKKPRKTRHESTLG 150 KNHT H++ R ++ G K RKT +T G Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKTHRNTTFG 117 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 27.9 bits (59), Expect = 2.7 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 41 ASKWQSQ-RIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQNF*GIKGFARRVT 199 A WQ++ + Q T+ K+ M + + RPGT AW+ F G + R +T Sbjct: 408 AGSWQTENKGYQFWTRADKMG-MFTIANVRPGTYSLYAWVSGFIGDYKYVRDIT 460 >At3g48200.1 68416.m05259 expressed protein Length = 1088 Score = 27.9 bits (59), Expect = 2.7 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKP 207 ++I +A S H+ K H N I T ES G+ + + F + NLKP Sbjct: 546 EQIMVATSPYIGPHSFISKTHNNMINLKTSTNAESVFGLPLTAMEYRLFFETSNLKP 602 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 109 YHFCELCGFGYDLYDSLTLPF*CVFNP 29 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At5g56560.1 68418.m07058 F-box family protein contains F-box domain Pfam:PF00646 Length = 607 Score = 26.6 bits (56), Expect = 6.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 196 YPSCKTFDSLKILDPCQGWIRAWSSL 119 YP+C F SLK L+ C R W++L Sbjct: 475 YPACTVFSSLKYLELCTCSAR-WANL 499 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 8.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 109 YHFCELCGFGYDLYDSLTLP 50 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 26.2 bits (55), Expect = 8.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 109 YHFCELCGFGYDLY 68 +H E+CG G+DLY Sbjct: 33 FHHMEVCGIGHDLY 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,217,628 Number of Sequences: 28952 Number of extensions: 115015 Number of successful extensions: 357 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -