BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F08 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 2.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 4.8 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 4.8 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 271 ELHINSAPKPNTKYKPVN 218 ++H PKP TK KP + Sbjct: 244 KVHATKPPKPQTKTKPTS 261 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 490 W*STTVSFVLTTRS 531 W STT SFVL R+ Sbjct: 349 WISTTTSFVLNNRA 362 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 412 PTMKSEKYSTIEKQAYTTQYVSHFVSSSFC 323 PT+ S+K S I+ T+Y+ C Sbjct: 281 PTLPSDKLSKIQTLKLATRYIDFLFQVLHC 310 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,873 Number of Sequences: 438 Number of extensions: 4235 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -