BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F07 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.2 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 5.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.9 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 21 9.1 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 187 GFGYKGSIFHRVIPN 231 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 187 GFGYKGSIFHRVIPN 231 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 187 GFGYKGSIFHRVIPN 231 GFGY+ ++ ++V+P+ Sbjct: 15 GFGYESNVKYQVVPS 29 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 515 LEVFPDWLPKVSICLTTSMPSTTFPKTTCLPSSQ 414 L V+P++ V +C S ++ KT C +Q Sbjct: 643 LNVYPEFQENVQLCSEISESYSSNNKTLCKCDAQ 676 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 21.4 bits (43), Expect = 9.1 Identities = 5/15 (33%), Positives = 12/15 (80%) Frame = +3 Query: 123 LISAVTPKSMXKLPC 167 +++A+TP ++ + PC Sbjct: 14 IVTALTPSTLGRFPC 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,211 Number of Sequences: 438 Number of extensions: 4053 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -