BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F06 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0153 - 1352982-1353731 31 0.64 01_05_0162 + 18759647-18759663,18760128-18760131,18760270-187606... 31 0.84 11_06_0506 - 24380469-24380632,24381737-24383893,24384488-243845... 30 1.5 06_03_0926 + 26001430-26001738 29 4.5 01_06_0878 - 32669790-32669846,32670206-32670299,32670384-326704... 28 5.9 10_06_0162 - 11348250-11349531,11349571-11349671 28 7.8 >01_01_0153 - 1352982-1353731 Length = 249 Score = 31.5 bits (68), Expect = 0.64 Identities = 24/58 (41%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Frame = +3 Query: 519 NDIAKQCQAAGCICNLALG-DSRAGVAV------TKSAGPYLIAALDNLTTELAVRCC 671 ND KQC AA C A G D G V T GP AALD L+ E +CC Sbjct: 64 NDEVKQCAAACKECVEAPGGDFNGGAFVCSDWFSTVDPGPKCTAALDGLSMERPWKCC 121 >01_05_0162 + 18759647-18759663,18760128-18760131,18760270-18760617, 18760801-18761016,18763367-18763435,18763560-18764209, 18764993-18765089,18765170-18765223,18765305-18765435, 18766818-18767008,18767937-18768574 Length = 804 Score = 31.1 bits (67), Expect = 0.84 Identities = 21/59 (35%), Positives = 27/59 (45%) Frame = +3 Query: 480 NGALRGLIRELTGNDIAKQCQAAGCICNLALGDSRAGVAVTKSAGPYLIAALDNLTTEL 656 +G L ++R L DI + AAG I NLAL S G V P L ++L L Sbjct: 148 SGMLTRMVRFLDDEDIKVKEAAAGIISNLALSHSNHGALVEAGVIPKLKGNKESLDWNL 206 >11_06_0506 - 24380469-24380632,24381737-24383893,24384488-24384541, 24384543-24384597,24384914-24384916,24385192-24385231, 24385576-24385632,24388124-24388412,24389764-24389771, 24390633-24390688,24391207-24391488,24391651-24391811, 24391887-24392121,24392860-24392943,24393022-24393117, 24393333-24394055,24396523-24396987 Length = 1642 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +3 Query: 372 IVNILK-TKTSISVTELSALKNMLNDDRKTMELVLSVNGALRGLIRELTGNDIAKQCQAA 548 I++ LK I V S LKN+ + LS + + L++ L + ++ Q A Sbjct: 401 ILDALKHASVDIRVAACSCLKNISRSSKVLSAGKLSCDTFIAPLVQLLYDSSMSVQVAAL 460 Query: 549 GCICNLAL 572 G ICN+A+ Sbjct: 461 GAICNIAV 468 >06_03_0926 + 26001430-26001738 Length = 102 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 162 RYLLICALGXPGQXRGAXCXKWMRADASAXSGFDKI 55 R + C G PG+ R +W R A+ G+D + Sbjct: 17 RTTVCCCFGSPGERRSGEKLRWRRRVAAGEFGYDPL 52 >01_06_0878 - 32669790-32669846,32670206-32670299,32670384-32670499, 32670786-32671096,32672243-32672364,32672754-32672870, 32672982-32673054,32673416-32673542,32673659-32673727, 32673811-32674170,32674493-32674633 Length = 528 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 27 PTFFKISPFKSCQIRSXRSHLLSST 101 PTF + PF S I R+HL SST Sbjct: 191 PTFLRGKPFSSINIWMNRAHLRSST 215 >10_06_0162 - 11348250-11349531,11349571-11349671 Length = 460 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -1 Query: 658 ASSVVRLSSAAIRYGPADLVTATPALLSPRARLQMQPAA 542 A+ V+R ++ +R G DLV A++ PR R+++ PAA Sbjct: 40 AAPVLRRTAELLR-GHPDLVAEINAVIYPRNRVELVPAA 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,356,506 Number of Sequences: 37544 Number of extensions: 239491 Number of successful extensions: 470 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -