BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F06 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_15543| Best HMM Match : DUF1311 (HMM E-Value=6.2) 28 6.0 >SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 50.8 bits (116), Expect = 1e-06 Identities = 29/101 (28%), Positives = 48/101 (47%) Frame = +3 Query: 366 KDIVNILKTKTSISVTELSALKNMLNDDRKTMELVLSVNGALRGLIRELTGNDIAKQCQA 545 +D ++ S ++ L +L+ + + + V LR ++ LTG++I Q +A Sbjct: 60 RDYAKAIQKYDSNTLHCLRSLRKAFAQGSELISAFMGVENGLRSVVGYLTGHNIDLQLEA 119 Query: 546 AGCICNLALGDSRAGVAVTKSAGPYLIAALDNLTTELAVRC 668 A CI NL+ G + V K+A PYLI L L +C Sbjct: 120 AWCITNLSAGTHEDTLRVLKAAAPYLITYLSGQNLSLQDQC 160 >SB_15543| Best HMM Match : DUF1311 (HMM E-Value=6.2) Length = 163 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 504 RELTGNDIAKQCQAAGCICNLALGDSRA 587 R L G D K+ + A CI +L+ GD R+ Sbjct: 73 RNLLGCDAVKKLREASCIFDLSFGDERS 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,020,874 Number of Sequences: 59808 Number of extensions: 294186 Number of successful extensions: 428 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -