BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_F03 (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.4 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 4.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.9 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 77 ISKVSNLQNHHNDNASLVNAGPSA 6 ++K+S++ DNA++VN GP A Sbjct: 227 VTKMSSINPCIFDNATIVNNGPEA 250 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +3 Query: 219 GFGYKGSIFHRVIPN 263 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +3 Query: 219 GFGYKGSIFHRVIPN 263 GFGY+ ++ ++V+P+ Sbjct: 389 GFGYESNVKYQVVPS 403 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +3 Query: 219 GFGYKGSIFHRVIPN 263 GFGY+ ++ ++V+P+ Sbjct: 15 GFGYESNVKYQVVPS 29 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 547 LEVFPDWLPKVSICLTTSMPSTTFPKTTCLPSSQ 446 L V+P++ V +C S ++ KT C +Q Sbjct: 643 LNVYPEFQENVQLCSEISESYSSNNKTLCKCDAQ 676 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,265 Number of Sequences: 438 Number of extensions: 4139 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -