BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E22 (634 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16980.1 68414.m02062 alpha, alpha-trehalose-phosphate syntha... 31 0.48 At3g01860.2 68416.m00131 expressed protein 30 1.1 At3g01860.1 68416.m00130 expressed protein 30 1.1 At5g49945.1 68418.m06184 expressed protein strong similarity to ... 29 2.6 At3g13340.1 68416.m01679 WD-40 repeat family protein contains Pf... 29 2.6 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 29 3.4 At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containi... 29 3.4 At5g53800.1 68418.m06685 expressed protein 29 3.4 At3g50550.1 68416.m05528 expressed protein isoform contains a n... 29 3.4 At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein ... 29 3.4 At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein ... 29 3.4 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 29 3.4 At5g53930.1 68418.m06710 expressed protein 28 4.5 At5g15140.1 68418.m01774 aldose 1-epimerase family protein simil... 28 4.5 At4g24330.1 68417.m03492 expressed protein hypothetical protein ... 28 4.5 At4g11970.2 68417.m01906 YT521-B-like family protein contains Pf... 28 4.5 At4g11970.1 68417.m01905 YT521-B-like family protein contains Pf... 28 4.5 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 28 4.5 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 28 4.5 At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein... 28 5.9 At4g32190.1 68417.m04581 centromeric protein-related low similar... 28 5.9 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 28 5.9 At3g29075.1 68416.m03637 glycine-rich protein 28 5.9 At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearl... 28 5.9 At3g53640.1 68416.m05925 protein kinase family protein contains ... 27 7.8 At3g15600.1 68416.m01976 hypothetical protein low similarity to ... 27 7.8 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 27 7.8 >At1g16980.1 68414.m02062 alpha, alpha-trehalose-phosphate synthase, UDP-forming, putative / trehalose-6-phosphate synthase, putative / UDP-glucose-glucosephosphate glucosyltransferase, putative similar to trehalose-6-phosphate synthase SL-TPS/P [Selaginella lepidophylla] GI:4100325; contains Pfam profiles PF00982: Glycosyltransferase family 20, PF02358: Trehalose-phosphatase Length = 821 Score = 31.5 bits (68), Expect = 0.48 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 224 LYDIDVMADKIRINSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRKHE 370 L+ + V+AD +S F E Y P D+ +EN KR ++ VR+RK E Sbjct: 767 LHKLAVVADTTMTDS-FSDSEIYEPRDANA--NENSKRWINSVRRRKVE 812 >At3g01860.2 68416.m00131 expressed protein Length = 159 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 278 QKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMY 394 ++ + + E ++N+KRLL+ ++ + E D EEE Y Sbjct: 47 EENKHGEEEEEASPTDNKKRLLELFKETQDEEDEEEEDY 85 >At3g01860.1 68416.m00130 expressed protein Length = 223 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 278 QKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMY 394 ++ + + E ++N+KRLL+ ++ + E D EEE Y Sbjct: 111 EENKHGEEEEEASPTDNKKRLLELFKETQDEEDEEEEDY 149 >At5g49945.1 68418.m06184 expressed protein strong similarity to unknown protein (pir||T09896) Length = 480 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 284 LFGQILNLFLFYQPSRRY-HKVLKYFKLKLTRHSARLRLF 168 L + LN+F FY RRY H +L +LK +RH R+F Sbjct: 213 LLKEALNVFKFYASGRRYCHGLLATMELK-SRHDLISRVF 251 >At3g13340.1 68416.m01679 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (3 copies, 1 significant); similar to Trp-Asp repeat protein (PIR:T40094) [Schizosaccharomyces] Length = 447 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 362 KHESDSEEEMYAFXXXXXXXXQKDDLGIADSDVEGQEKSDDDLPDSKA 505 ++ D ++EM + DDLG +DSDVE + S++ + D+ A Sbjct: 10 EYMEDVDDEMEDVEDDMDEEFRGDDLGASDSDVEEFDYSNNKVADTTA 57 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +2 Query: 275 DQKENYAPSDSEDGYSEN--EKRLLDKVRKRKHESDSEEEMYAFXXXXXXXXQKDDLGIA 448 DQ+ A SD+ED + E +D + + ES+ ++E ++DD G + Sbjct: 22 DQENLKAESDNEDDQLPDGIEDDEVDSMEDDEGESEEDDE---------GDTEEDDEGDS 72 Query: 449 DSDVEGQEKSDDD 487 + D EG+ K D+D Sbjct: 73 EEDDEGENKEDED 85 >At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 521 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = +3 Query: 324 KMKSDYWIKYVRENMSLIVKRKC 392 KM++DY +K +E+++L+VK+ C Sbjct: 200 KMENDYGLKRDKESLTLVVKKLC 222 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 299 SDSEDGYSENEKRLLDKVRKRKHESDSEEE 388 SDSE+ SE+E+R + RK + E + E + Sbjct: 119 SDSEESESEDERRRRKRKRKEREEEEKERK 148 >At3g50550.1 68416.m05528 expressed protein isoform contains a non-consensus AT donor site at intron 1 Length = 95 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/85 (24%), Positives = 34/85 (40%) Frame = +2 Query: 242 MADKIRINSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMYAFXXXXXXX 421 MAD+ I + E Y D +D ++ E D + ++ S + E + Sbjct: 1 MADEKEIVDIYSSDEEYDEDDDDDDDTDGESSDEDDEEEDRNLSGDDSES-SEDDYTDSN 59 Query: 422 XQKDDLGIADSDVEGQEKSDDDLPD 496 DD D D E +E+ +D L D Sbjct: 60 SDSDDDDEEDDDDEEEEEEEDSLVD 84 >At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 412 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 428 KDDLGIADSDVEGQEKSDDDLPDSKAWGKNKQSYYATDYVDKDYGGFGD 574 KD+ G+ D D + K DDD S + G K++ KD G GD Sbjct: 155 KDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKEN-EGNGGSGKDNNGNGD 202 >At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 324 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 428 KDDLGIADSDVEGQEKSDDDLPDSKAWGKNKQSYYATDYVDKDYGGFGD 574 KD+ G+ D D + K DDD S + G K++ KD G GD Sbjct: 67 KDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKEN-EGNGGSGKDNNGNGD 114 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/52 (21%), Positives = 28/52 (53%) Frame = +2 Query: 230 DIDVMADKIRINSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEE 385 D D ADK + + +D+K A ++ E+ E++++ + +++E+ + Sbjct: 291 DADAEADKGKESKEYDEKTTEAEANKENDTQESDEKKTEAAANKENETQESD 342 >At5g53930.1 68418.m06710 expressed protein Length = 529 Score = 28.3 bits (60), Expect = 4.5 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +2 Query: 266 SRFDQKENYAPSDSEDGYSENEKRLLDKVR-KRKHESDSEEEMYAFXXXXXXXXQKDDLG 442 S+ ++ Y+ S+S+D S++++ L K R KRK E+ +++ +K DL Sbjct: 69 SKKRSRKRYSSSESDDD-SDDDRLLKKKKRSKRKDENVGKKK----KKVVSRKRRKRDLS 123 Query: 443 IADSDVEGQEKSDDDLPDSKAWGKNK 520 + + E + + D K W +++ Sbjct: 124 SSSTSSEQSDNDGSESDDGKRWSRDR 149 >At5g15140.1 68418.m01774 aldose 1-epimerase family protein similar to SP|P05149 Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase) from Acinetobacter calcoaceticus; contains Pfam profile PF01263 Aldose 1-epimerase Length = 490 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +2 Query: 308 EDGYSENEKRLLDKVRKRKHESDSEEEMYAFXXXXXXXXQKDDLGIADSDVEGQEKSDDD 487 E+ ++EK+ +DK + H+ D ++E DD +D D + + DDD Sbjct: 87 ENKDKDDEKKHVDKKKSGGHDKDDDDEKKHKDKKKDGHNDDDD---SDDDTDDDDDDDDD 143 Query: 488 LPD 496 D Sbjct: 144 DDD 146 >At4g24330.1 68417.m03492 expressed protein hypothetical protein - Caenorhabditis elegans,PID:e1350884 Length = 478 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 284 LFGQILNLFLFYQPSRRY-HKVLKYFKLKLTRHSARLRLF 168 L + N+F FY RRY H +L +LK +RH RLF Sbjct: 211 LLKEATNVFKFYASGRRYCHGLLATLELK-SRHDLISRLF 249 >At4g11970.2 68417.m01906 YT521-B-like family protein contains Pfam profile PF04146: YT521-B-like family Length = 359 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 428 KDDLGIADSDVEGQEKSDDDLPDSKAWGKNKQSYYATDYVDKD 556 +DD S E S DD ++ WG SY T Y ++D Sbjct: 222 RDDYSTKRSRAEPPSSSGDDEYNNNLWGHTPMSYPPTVYPNQD 264 >At4g11970.1 68417.m01905 YT521-B-like family protein contains Pfam profile PF04146: YT521-B-like family Length = 444 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 428 KDDLGIADSDVEGQEKSDDDLPDSKAWGKNKQSYYATDYVDKD 556 +DD S E S DD ++ WG SY T Y ++D Sbjct: 222 RDDYSTKRSRAEPPSSSGDDEYNNNLWGHTPMSYPPTVYPNQD 264 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 28.3 bits (60), Expect = 4.5 Identities = 22/100 (22%), Positives = 45/100 (45%), Gaps = 6/100 (6%) Frame = +2 Query: 275 DQKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMYAFXXXXXXXXQKDDLGIADS 454 +++E P DS + E ++L +++ E D ++E+ D+ +A+ Sbjct: 351 EEEEIDGPLDSPESVEELHEKLQEELNIDNEERDVKKEVVG-----EADETDDEYFVAEE 405 Query: 455 DVEGQEKSDDD------LPDSKAWGKNKQSYYATDYVDKD 556 D++G +S+D+ L + KNKQ + D+D Sbjct: 406 DMQGSSESEDEDDEMTLLKKMVSGQKNKQKNVVSKEEDED 445 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 248 DKIRINSRFDQKENYAPSDSEDGYSENEK-RLLDKVRKRKHESDSEEEM 391 +K+R D+KE D E E E+ + K R ++ ESD E M Sbjct: 804 EKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGETAM 852 >At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 275 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 275 DQKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMYA 397 D E P D+ +G +E EKR RK + +SDSE + A Sbjct: 148 DDDEEERP-DATNGKAEVEKRSKKSKRKHRSKSDSESDSEA 187 >At4g32190.1 68417.m04581 centromeric protein-related low similarity to SP|Q02224 Centromeric protein E (CENP-E protein) {Homo sapiens} Length = 783 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +2 Query: 287 NYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMYAFXXXXXXXXQKDDLGIADSDVEG 466 N P+ +++G +E+ L DK+ R H + + ++ +LG+ +SD+E Sbjct: 58 NTRPNINDNGSAESANVLFDKLFARTHRLERQTNQHSVYPDDDDLPY-SNLGVLESDLEA 116 Query: 467 Q----EKSDDDLPDSK 502 K ++DL D++ Sbjct: 117 ALVALLKREEDLHDAE 132 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 413 RQNQRKHTFPLHYQTHVFSYVLYPIIAFHFQNNHLLN 303 +Q QR H F + TH S ++ P + H + ++L+ Sbjct: 368 QQQQRHHAFNISQPTHPISTIISPSTSLHHASINILD 404 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +2 Query: 278 QKENYAPSDSEDGYSENEKRLL-----DKVRKRKHESDSEEE 388 +KE Y +D Y E +K+ D+ +K+KH +D ++E Sbjct: 189 KKEQYKEHHDDDDYDEKKKKKKDYNDDDEKKKKKHYNDDDDE 230 >At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearly identical to ubiquitin-protein ligase 2 [Arabidopsis thaliana] GI:7108523; E3, HECT-domain protein family; similar to ubiquitin-protein ligase 2 GI:7108523 from [Arabidopsis thaliana] Length = 3658 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 449 DSDVEGQE-KSDDDLPDSKAWGKNKQSYYATDYVDKDYGGFGDD 577 D D EG++ + DD+ DS G S TD D + G GD+ Sbjct: 2125 DMDDEGEDDEGDDEDADSVEDGAGVMSIAGTDVEDPEDTGLGDE 2168 >At3g53640.1 68416.m05925 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 642 Score = 27.5 bits (58), Expect = 7.8 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 239 VMADKIRINSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRKH--ESDSEEEMYAF 400 +++DKI +S + +Y+PSD S+ K K R H E +E+ +Y F Sbjct: 1 MVSDKIVESSHRKHRRSYSPSDEVVKSSKRHKHHHHKHRHSHHLDEDGNEKNVYPF 56 >At3g15600.1 68416.m01976 hypothetical protein low similarity to KED [Nicotiana tabacum] GI:8096269; contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 591 Score = 27.5 bits (58), Expect = 7.8 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +2 Query: 263 NSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRK-HESDSEEEMYAFXXXXXXXXQKDDL 439 + D KEN S D +E +K + ++R+ E+++E + + ++ Sbjct: 391 SKEIDDKENELEEGS-DAETEIDKEVAQGDKEREVGETETEIDKEVVQCDSDKEVAESEI 449 Query: 440 GIADSDVEGQEKSDDDLPDSK 502 G+A+S+ + + DD++ K Sbjct: 450 GVAESEKDKEVPQDDEMDGGK 470 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 27.5 bits (58), Expect = 7.8 Identities = 18/88 (20%), Positives = 36/88 (40%), Gaps = 2/88 (2%) Frame = +2 Query: 263 NSRFDQKENYAPSDSEDGYSENEKRLLDKVRKRKHESDSEEEMYAFXXXXXXXXQK--DD 436 +S ++ + + E E++K K K +H +E+ A + DD Sbjct: 253 SSSASSSDSSSSEEEESDEDESDKEENKKEEKFEHMVVGKEDDLAGDLKRNLDEENGDDD 312 Query: 437 LGIADSDVEGQEKSDDDLPDSKAWGKNK 520 + D D + + DDD+ + AW ++ Sbjct: 313 IEDEDDDDDDDDDDDDDVNEMVAWSNDE 340 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,198,721 Number of Sequences: 28952 Number of extensions: 185376 Number of successful extensions: 829 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -