BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E18 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1)... 226 9e-60 At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putat... 225 3e-59 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 82 4e-16 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 79 3e-15 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 34 0.075 At1g80910.1 68414.m09493 expressed protein 34 0.099 At3g55120.1 68416.m06121 chalcone-flavanone isomerase / chalcone... 32 0.30 At1g16020.2 68414.m01922 expressed protein 32 0.40 At1g16020.1 68414.m01921 expressed protein 32 0.40 At3g57570.1 68416.m06410 expressed protein 30 1.6 At4g16146.1 68417.m02449 expressed protein 28 6.5 At4g28395.1 68417.m04064 lipid transfer protein, putative identi... 27 8.6 >At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1) identical to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 266 Score = 226 bits (553), Expect = 9e-60 Identities = 107/185 (57%), Positives = 136/185 (73%), Gaps = 2/185 (1%) Frame = +2 Query: 110 APQFKATAVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGC 286 AP F+A AV + EF + LSDY GK YV+LFFYPLDFTFVCPTEI AFS++ EF K+ Sbjct: 79 APDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNT 138 Query: 287 EVLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLF 466 EVLG S DS F+HLAW+ T RK GGLG +N PLISD + IS+ +GVL + GI RGLF Sbjct: 139 EVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLF 198 Query: 467 IIDDKQNLRQITINDLPVGRSVEETLRLVQAFQFTDKH-GEVCPANWRPGAKTIKPDTKA 643 IID + ++ TIN+L +GRSV+ET+R +QA Q+ ++ EVCPA W+PG K++KPD K Sbjct: 199 IIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKL 258 Query: 644 AXEYF 658 + EYF Sbjct: 259 SKEYF 263 >At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putative very strong similarity to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 273 Score = 225 bits (549), Expect = 3e-59 Identities = 105/185 (56%), Positives = 137/185 (74%), Gaps = 2/185 (1%) Frame = +2 Query: 110 APQFKATAVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGC 286 AP F+A AV + EF + LS+Y GK YV+LFFYPLDFTFVCPTEI AFS++ +EF K+ Sbjct: 86 APDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNT 145 Query: 287 EVLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLF 466 EVLG S DS F+HLAW+ T RK GGLG +N PL+SD + IS+ +GVL + GI RGLF Sbjct: 146 EVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLF 205 Query: 467 IIDDKQNLRQITINDLPVGRSVEETLRLVQAFQFTDKH-GEVCPANWRPGAKTIKPDTKA 643 IID + ++ TIN+L +GRSV+ET+R +QA Q+ ++ EVCPA W+PG K++KPD K Sbjct: 206 IIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKL 265 Query: 644 AXEYF 658 + EYF Sbjct: 266 SKEYF 270 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 81.8 bits (193), Expect = 4e-16 Identities = 48/152 (31%), Positives = 72/152 (47%), Gaps = 3/152 (1%) Frame = +2 Query: 164 LSDY-KGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLAWIN 340 L DY + VLF +P DFT VC TE+ A ++ A EF K G ++LG S D +H WI Sbjct: 24 LHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIK 83 Query: 341 TPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITINDLPV 520 +N P+I+D + I ++D P R L I+ ++ + Sbjct: 84 DIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTT 143 Query: 521 GRSVEETLRLVQAFQFTDKHGE--VCPANWRP 610 GR+++E LR + + KH P NW+P Sbjct: 144 GRNMDEVLRALDSLLMASKHNNKIATPVNWKP 175 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 79.0 bits (186), Expect = 3e-15 Identities = 44/137 (32%), Positives = 77/137 (56%), Gaps = 1/137 (0%) Frame = +2 Query: 152 KDISLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLA 331 K +SL YKGK VVL+FYP D T C + AF + ++F+K G EV+G S D +H A Sbjct: 86 KPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKA 145 Query: 332 WINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETG-IPFRGLFIIDDKQNLRQITIN 508 + + + + L+SD+ +++ +D+GV + G +P R +++D ++ I N Sbjct: 146 FASKYK-------LPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNN 198 Query: 509 DLPVGRSVEETLRLVQA 559 + ++ETL+ ++A Sbjct: 199 QFQPEKHIDETLKFLKA 215 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 34.3 bits (75), Expect = 0.075 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 137 VNGEFKDISLSD-YKGKYVVLFFYPLDFTFVCPTE-IIAFSEKADEFRKIGCE-VLGAST 307 V+ +F LSD +KGK VV+F P +T VC + + ++ D+F+ G + V+ S Sbjct: 58 VSSKFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSV 117 Query: 308 DSHFTHLAW 334 + F W Sbjct: 118 NDPFAINGW 126 >At1g80910.1 68414.m09493 expressed protein Length = 497 Score = 33.9 bits (74), Expect = 0.099 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 7/61 (11%) Frame = +2 Query: 155 DISLSDYKGKYV--VLFFYPLDFTFVCPTEIIAFSEKADEFRKI-----GCEVLGASTDS 313 D+ ++G+ + +LFFYP D TF +I SE F ++ CEV+ A S Sbjct: 19 DLRRGQHEGQELDKILFFYPPDLTFSTQLSVIGLSEGLITFTRLFSPEAACEVIEAERHS 78 Query: 314 H 316 H Sbjct: 79 H 79 >At3g55120.1 68416.m06121 chalcone-flavanone isomerase / chalcone isomerase (CHI) identical to SP|P41088 Length = 246 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = -1 Query: 609 GLQLAGHTSPCLSVNWKACTSRRVSSTDLPTGRSLIVICLRFCLSSMMKSPRKGMPVSSS 430 G+ L G+ P LSV WK T+ ++ + +P R ++ + MK P G S Sbjct: 62 GVYLEGNAVPSLSVKWKGKTTEELTES-IPFFREIVTGAFEKFIKVTMKLPLTGQQYSEK 120 Query: 429 ST 424 T Sbjct: 121 VT 122 >At1g16020.2 68414.m01922 expressed protein Length = 502 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +2 Query: 191 VLFFYPLDFTFVCPTEIIAFSEKADEFRKI-----GCEVLGASTDSH 316 +LFFYP D F +I SE F ++ CEV+ A SH Sbjct: 31 ILFFYPADLDFSTQLSVIGLSEGLITFTRLFSPEAACEVIEAERHSH 77 >At1g16020.1 68414.m01921 expressed protein Length = 515 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +2 Query: 191 VLFFYPLDFTFVCPTEIIAFSEKADEFRKI-----GCEVLGASTDSH 316 +LFFYP D F +I SE F ++ CEV+ A SH Sbjct: 31 ILFFYPADLDFSTQLSVIGLSEGLITFTRLFSPEAACEVIEAERHSH 77 >At3g57570.1 68416.m06410 expressed protein Length = 1057 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -1 Query: 609 GLQLAGHTSPCLSVNWKACTSRRVSSTDLPTGRSLIVICLRFCLSSMMKSPRKGMPVSSS 430 G + +T CL + C+S STD+ T + + I R C+++++ S + P SS Sbjct: 875 GYSVLDYTIHCLIEDRSNCSSIPKLSTDILTCENPLPIPFRLCMANVIISACQKNPESSK 934 Query: 429 ST 424 T Sbjct: 935 KT 936 >At4g16146.1 68417.m02449 expressed protein Length = 102 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 350 KQGGLGPMNIPLISDKSHRI---SRDYGVLDEETGIPFRGLFIID 475 K GGL P PLIS S R S D+ +L +E I R + I+ Sbjct: 25 KYGGLVPKKKPLISKDSKRAFFDSADWALLKQEASIDQRTIAAIE 69 >At4g28395.1 68417.m04064 lipid transfer protein, putative identical to anther-specific gene ATA7 [gi:2746339]; contains Pfam protease inhibitor/seed storage/LTP family domain Length = 180 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 408 MRCDLSLIRGMFMGPSPPCLRGVLIQARCVKCES 307 M C + + G+F PSP C RGV VK S Sbjct: 77 MPC-MGFVEGIFQQPSPDCCRGVTHLNNVVKFTS 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,902,423 Number of Sequences: 28952 Number of extensions: 230951 Number of successful extensions: 902 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -