BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E17 (589 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 26 0.21 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 26 0.21 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.5 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 5.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.8 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 7.7 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 7.7 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 26.2 bits (55), Expect = 0.21 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 344 DGHLLTRTFLVTERITLADVIVFSTLLHAFQHV 442 DGH++ TF +E + DV++ + L+ F+ V Sbjct: 624 DGHVILETFHFSEADFVMDVVMLAVLIVGFRLV 656 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 26.2 bits (55), Expect = 0.21 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 344 DGHLLTRTFLVTERITLADVIVFSTLLHAFQHV 442 DGH++ TF +E + DV++ + L+ F+ V Sbjct: 624 DGHVILETFHFSEADFVMDVVMLAVLIVGFRLV 656 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 576 FLGSYVGGAAQSVSEPTTADTCGWWATV 493 F+ S GG S+ + T CG W + Sbjct: 208 FVLSRAGGLVNSLYQNATRKVCGVWKRI 235 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 336 KYWTDIFSHAPSLLPRESHLPMSLS-SVHCC 425 K + D+F+ + L+PR P+S S H C Sbjct: 182 KVFVDLFNLSTFLIPRSYIPPLSTSMRSHLC 212 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 336 KYWTDIFSHAPSLLPRESHLPMSLS-SVHCC 425 K + D+F+ + L+PR P+S S H C Sbjct: 342 KVFVDLFNLSTFLIPRSYIPPLSTSMRSHLC 372 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 336 KYWTDIFSHAPSLLPRESHLPMSLS-SVHCC 425 K + D+F+ + L+PR P+S S H C Sbjct: 342 KVFVDLFNLSTFLIPRSYIPPLSTSMRSHLC 372 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 336 KYWTDIFSHAP 368 K+WTDI++ P Sbjct: 501 KFWTDIYNSNP 511 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 336 KYWTDIFSHAP 368 K+WTDI++ P Sbjct: 503 KFWTDIYNSNP 513 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,669 Number of Sequences: 336 Number of extensions: 2766 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -